PDB entry 5kob

View 5kob on RCSB PDB site
Description: Crystal structure of a peptide deformylase from Burkholderia xenovorans
Class: hydrolase
Keywords: SSGCID, peptide deformylase, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, HYDROLASE
Deposited on 2016-06-30, released 2016-07-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptide deformylase
    Species: Burkholderia xenovorans (strain LB400) [TaxId:266265]
    Gene: def, Bxe_A1677
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13XB1 (8-End)
      • expression tag (6-7)
    Domains in SCOPe 2.08: d5koba1, d5koba2
  • Chain 'B':
    Compound: Peptide deformylase
    Species: Burkholderia xenovorans (strain LB400) [TaxId:266265]
    Gene: def, Bxe_A1677
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5kobb_
  • Chain 'C':
    Compound: Peptide deformylase
    Species: Burkholderia xenovorans (strain LB400) [TaxId:266265]
    Gene: def, Bxe_A1677
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5kobc_
  • Chain 'D':
    Compound: Peptide deformylase
    Species: Burkholderia xenovorans (strain LB400) [TaxId:266265]
    Gene: def, Bxe_A1677
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5kobd_
  • Heterogens: FE2, FMT, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5kobA (A:)
    mahhhhhhmireilkmgdprllriadpvdhfdtpelhelvkdmfetmhdangaglaapqi
    gvnlqvvifgfghnerypdappvpetvlinptitpvsqdmeegwegclsvpglrgavsrf
    smikyhgfdqygkpidrvaegfharvvqhecdhligklypmrindfakfgftevlfpdmd
    pnsdd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kobA (A:)
    hhmireilkmgdprllriadpvdhfdtpelhelvkdmfetmhdangaglaapqigvnlqv
    vifgfghnerypdappvpetvlinptitpvsqdmeegwegclsvpglrgavsrfsmikyh
    gfdqygkpidrvaegfharvvqhecdhligklypmrindfakfgftevlfp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5kobB (B:)
    mahhhhhhmireilkmgdprllriadpvdhfdtpelhelvkdmfetmhdangaglaapqi
    gvnlqvvifgfghnerypdappvpetvlinptitpvsqdmeegwegclsvpglrgavsrf
    smikyhgfdqygkpidrvaegfharvvqhecdhligklypmrindfakfgftevlfpdmd
    pnsdd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kobB (B:)
    mireilkmgdprllriadpvdhfdtpelhelvkdmfetmhdangaglaapqigvnlqvvi
    fgfgppvpetvlinptitpvsqdmeegwegclsvpglrgavsrfsmikyhgfdqygkpid
    rvaegfharvvqhecdhligklypmrindfakfgftevlfp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5kobC (C:)
    mahhhhhhmireilkmgdprllriadpvdhfdtpelhelvkdmfetmhdangaglaapqi
    gvnlqvvifgfghnerypdappvpetvlinptitpvsqdmeegwegclsvpglrgavsrf
    smikyhgfdqygkpidrvaegfharvvqhecdhligklypmrindfakfgftevlfpdmd
    pnsdd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kobC (C:)
    ireilkmgdprllriadpvdhfdtpelhelvkdmfetmhdangaglaapqigvnlqvvif
    gfghnerypdappvpetvlinptitpvsqdmeegwegclsvpglrgavsrfsmikyhgfd
    qygkpidrvaegfharvvqhecdhligklypmrindfakfgftevlfpdm
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5kobD (D:)
    mahhhhhhmireilkmgdprllriadpvdhfdtpelhelvkdmfetmhdangaglaapqi
    gvnlqvvifgfghnerypdappvpetvlinptitpvsqdmeegwegclsvpglrgavsrf
    smikyhgfdqygkpidrvaegfharvvqhecdhligklypmrindfakfgftevlfpdmd
    pnsdd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kobD (D:)
    ireilkmgdprllriadpvdhfdtpelhelvkdmfetmhdangaglaapqigvnlqvvif
    gfvpetvlinptitpvsqdmeegwegclsvpglrgavsrfsmikyhgfdqygkpidrvae
    gfharvvqhecdhligklypmrindfakfgftevlfp