PDB entry 5ko2

View 5ko2 on RCSB PDB site
Description: mouse pgp 34 linker deleted mutant hg derivative
Deposited on 2016-06-29, released 2016-11-30
The last revision was dated 2017-01-25, with a file datestamp of 2017-01-20.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Multidrug resistance protein 1a
    Species: Mus musculus [TaxId:10090]
    Gene: Abcb1a, Abcb4, Mdr1a, Mdr3, Pgy-3, Pgy3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21447
      • engineered mutation (551)
      • engineered mutation (1162)
  • Chain 'B':
    Compound: Multidrug resistance protein 1a
    Species: Mus musculus [TaxId:10090]
    Gene: Abcb1a, Abcb4, Mdr1a, Mdr3, Pgy-3, Pgy3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21447
      • engineered mutation (551)
      • engineered mutation (1162)
  • Heterogens: HG

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5ko2A (A:)
    meleedlkgradknfskmgkkskkekkekkpavsvltmfryagwldrlymlvgtlaaiih
    gvalplmmlifgdmtdsfasvgnvsknstnmseadkramfakleeemttyayyytgigag
    vlivayiqvsfwclaagrqihkirqkffhaimnqeigwfdvhdvgelntrltddvskine
    gigdkigmffqamatffggfiigftrgwkltlvilaispvlglsagiwakilssftdkel
    hayakagavaeevlaairtviafggqkkelerynnnleeakrlgikkaitanismgaafl
    liyasyalafwygtslviskeysigqvltvffsvligafsvgqaspnieafanargaaye
    vfkiidnkpsidsfsksghkpdniqgnlefknihfsypsrkevqilkglnlkvksgqtva
    lvgnsgcgksttvqlmqrlydpldgmvsidgqdirtinvrylreiigvvsqepvlfatti
    aenirygredvtmdeiekavkeanaydfimklphqfdtlvgergaqlsggqkqriaiara
    lvrnpkillldqatsaldteseavvqaaldkaregrttiviahrlstvrnadviagfdgg
    viveqgnhdelmrekgiyfklvmtqtagneielgneackskdeidnldaldedvppasfw
    rilklnstewpyfvvgifcaiingglqpafsvifskvvgvftnggppetqrqnsnlfsll
    flilgiisfitfflqgftfgkageiltkrlrymvfksmlrqdvswfddpknttgalttrl
    andaaqvkgatgsrlavifqnianlgtgiiisliygwqltllllaivpiiaiagvvemkm
    lsgqalkdkkelegsgkiateaienfrtvvsltreqkfetmyaqslqipyrnamkkahvf
    gitfsftqammyfsyaacfrfgaylvtqqlmtfenvllvfsaivfgamavgqvssfapdy
    akatvsashiiriiektpeidsystqglkpnmlegnvqfsgvvfnyptrpsipvlqglsl
    evkkgqtlalvgssgcgkstvvqllerfydpmagsvfldgkeikqlnvqwlraqlgivsq
    epilfdcsiaeniaygdnsrvvsyeeivraakeanihqfidslpdkyntrvgdkgtqlsg
    gqkqriaiaralvrqphillldqatsaldtesekvvqealdkaregrtciviahrlstiq
    nadlivviqngkvkehgthqqllaqkgiyfsmvsvqagakrshhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5ko2A (A:)
    ekkpavsvltmfryagwldrlymlvgtlaaiihgvalplmmlifgdmtdsfasvgnvskn
    stnmseadkramfakleeemttyayyytgigagvlivayiqvsfwclaagrqihkirqkf
    fhaimnqeigwfdvhdvgelntrltddvskinegigdkigmffqamatffggfiigftrg
    wkltlvilaispvlglsagiwakilssftdkelhayakagavaeevlaairtviafggqk
    kelerynnnleeakrlgikkaitanismgaaflliyasyalafwygtslviskeysigqv
    ltvffsvligafsvgqaspnieafanargaayevfkiidnkpsidsfsksghkpdniqgn
    lefknihfsypsrkevqilkglnlkvksgqtvalvgnsgcgksttvqlmqrlydpldgmv
    sidgqdirtinvrylreiigvvsqepvlfattiaenirygredvtmdeiekavkeanayd
    fimklphqfdtlvgergaqlsggqkqriaiaralvrnpkillldqatsaldteseavvqa
    aldkaregrttiviahrlstvrnadviagfdggviveqgnhdelmrekgiyfklvmtqtd
    vppasfwrilklnstewpyfvvgifcaiingglqpafsvifskvvgvftnggppetqrqn
    snlfsllflilgiisfitfflqgftfgkageiltkrlrymvfksmlrqdvswfddpkntt
    galttrlandaaqvkgatgsrlavifqnianlgtgiiisliygwqltllllaivpiiaia
    gvvemkmlsgqalkdkkelegsgkiateaienfrtvvsltreqkfetmyaqslqipyrna
    mkkahvfgitfsftqammyfsyaacfrfgaylvtqqlmtfenvllvfsaivfgamavgqv
    ssfapdyakatvsashiiriiektpeidsystqglkpnmlegnvqfsgvvfnyptrpsip
    vlqglslevkkgqtlalvgssgcgkstvvqllerfydpmagsvfldgkeikqlnvqwlra
    qlgivsqepilfdcsiaeniaygdnsrvvsyeeivraakeanihqfidslpdkyntrvgd
    kgtqlsggqkqriaiaralvrqphillldqatsaldtesekvvqealdkaregrtcivia
    hrlstiqnadlivviqngkvkehgthqqllaqkgiyfsmvsvqag
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5ko2B (B:)
    meleedlkgradknfskmgkkskkekkekkpavsvltmfryagwldrlymlvgtlaaiih
    gvalplmmlifgdmtdsfasvgnvsknstnmseadkramfakleeemttyayyytgigag
    vlivayiqvsfwclaagrqihkirqkffhaimnqeigwfdvhdvgelntrltddvskine
    gigdkigmffqamatffggfiigftrgwkltlvilaispvlglsagiwakilssftdkel
    hayakagavaeevlaairtviafggqkkelerynnnleeakrlgikkaitanismgaafl
    liyasyalafwygtslviskeysigqvltvffsvligafsvgqaspnieafanargaaye
    vfkiidnkpsidsfsksghkpdniqgnlefknihfsypsrkevqilkglnlkvksgqtva
    lvgnsgcgksttvqlmqrlydpldgmvsidgqdirtinvrylreiigvvsqepvlfatti
    aenirygredvtmdeiekavkeanaydfimklphqfdtlvgergaqlsggqkqriaiara
    lvrnpkillldqatsaldteseavvqaaldkaregrttiviahrlstvrnadviagfdgg
    viveqgnhdelmrekgiyfklvmtqtagneielgneackskdeidnldaldedvppasfw
    rilklnstewpyfvvgifcaiingglqpafsvifskvvgvftnggppetqrqnsnlfsll
    flilgiisfitfflqgftfgkageiltkrlrymvfksmlrqdvswfddpknttgalttrl
    andaaqvkgatgsrlavifqnianlgtgiiisliygwqltllllaivpiiaiagvvemkm
    lsgqalkdkkelegsgkiateaienfrtvvsltreqkfetmyaqslqipyrnamkkahvf
    gitfsftqammyfsyaacfrfgaylvtqqlmtfenvllvfsaivfgamavgqvssfapdy
    akatvsashiiriiektpeidsystqglkpnmlegnvqfsgvvfnyptrpsipvlqglsl
    evkkgqtlalvgssgcgkstvvqllerfydpmagsvfldgkeikqlnvqwlraqlgivsq
    epilfdcsiaeniaygdnsrvvsyeeivraakeanihqfidslpdkyntrvgdkgtqlsg
    gqkqriaiaralvrqphillldqatsaldtesekvvqealdkaregrtciviahrlstiq
    nadlivviqngkvkehgthqqllaqkgiyfsmvsvqagakrshhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5ko2B (B:)
    ekkpavsvltmfryagwldrlymlvgtlaaiihgvalplmmlifgdmtdsfasvgnvskn
    stnmseadkramfakleeemttyayyytgigagvlivayiqvsfwclaagrqihkirqkf
    fhaimnqeigwfdvhdvgelntrltddvskinegigdkigmffqamatffggfiigftrg
    wkltlvilaispvlglsagiwakilssftdkelhayakagavaeevlaairtviafggqk
    kelerynnnleeakrlgikkaitanismgaaflliyasyalafwygtslviskeysigqv
    ltvffsvligafsvgqaspnieafanargaayevfkiidnkpsidsfsksghkpdniqgn
    lefknihfsypsrkevqilkglnlkvksgqtvalvgnsgcgksttvqlmqrlydpldgmv
    sidgqdirtinvrylreiigvvsqepvlfattiaenirygredvtmdeiekavkeanayd
    fimklphqfdtlvgergaqlsggqkqriaiaralvrnpkillldqatsaldteseavvqa
    aldkaregrttiviahrlstvrnadviagfdggviveqgnhdelmrekgiyfklvmtqtd
    vppasfwrilklnstewpyfvvgifcaiingglqpafsvifskvvgvftnggppetqrqn
    snlfsllflilgiisfitfflqgftfgkageiltkrlrymvfksmlrqdvswfddpkntt
    galttrlandaaqvkgatgsrlavifqnianlgtgiiisliygwqltllllaivpiiaia
    gvvemkmlsgqalkdkkelegsgkiateaienfrtvvsltreqkfetmyaqslqipyrna
    mkkahvfgitfsftqammyfsyaacfrfgaylvtqqlmtfenvllvfsaivfgamavgqv
    ssfapdyakatvsashiiriiektpeidsystqglkpnmlegnvqfsgvvfnyptrpsip
    vlqglslevkkgqtlalvgssgcgkstvvqllerfydpmagsvfldgkeikqlnvqwlra
    qlgivsqepilfdcsiaeniaygdnsrvvsyeeivraakeanihqfidslpdkyntrvgd
    kgtqlsggqkqriaiaralvrqphillldqatsaldtesekvvqealdkaregrtcivia
    hrlstiqnadlivviqngkvkehgthqqllaqkgiyfsmvsvqa