PDB entry 5ko1

View 5ko1 on RCSB PDB site
Description: Pseudokinase Domain of MLKL bound to Compound 4.
Class: membrane proteins/inhibitor
Keywords: Pseudokinase domain MLKL Type1 inhibitor, MEMBRANE PROTEINS-INHIBITOR complex
Deposited on 2016-06-29, released 2016-11-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-11-23, with a file datestamp of 2016-11-18.
Experiment type: XRAY
Resolution: 2.16 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mixed lineage kinase domain-like protein
    Species: Homo sapiens [TaxId:9606]
    Gene: Mlkl
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ko1a_
  • Heterogens: 6UY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ko1A (A:)
    gseqikeikkeqlsgspwillrenevstlykgeyhrapvaikvfkklqagsiaivrqtfn
    keiktmkkfespnilrifgicidetvtppqfsivmeycelgtlrelldrekdltlgkrmv
    lvlgaarglyrlhhseapelhgkirssnflvtqgyqvklagfelrktqtsmslgttraat
    drvkstaylspqeledvfyqydvkseiysfgivlweiatgdipfqgcnsekirklvavkr
    qqeplgedcpselreiidecrahdpsvrpsvdeilkklstfsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ko1A (A:)
    qikeikkeqlsgspwillrenevstlykgeyhrapvaikvfkklqagsiaivrqtfnkei
    ktmkkfespnilrifgicidetvtppqfsivmeycelgtlrelldrekdltlgkrmvlvl
    gaarglyrlhhseapelhgkirssnflvtqgyqvklagfelrkdrvkstaylspqeledv
    fyqydvkseiysfgivlweiatgdipfqgcnsekirklvavkrqqeplgedcpselreii
    decrahdpsvrpsvdeilkklstfs