PDB entry 5knp

View 5knp on RCSB PDB site
Description: Crystal structure of Mycobacterium tuberculosis hypoxanthine guanine phosphoribosyltransferase in complex with [3S,4R]-(4-(Hypoxanthin-9-yl)pyrrolidin-3-yl)-oxymethanephosphonic acid
Class: transferase/inhibitor
Keywords: inhibitor, complex, phosphoribosyltransferase, nucleoside phosphonates, TRANSFERASE-INHIBITOR complex
Deposited on 2016-06-28, released 2017-09-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypoxanthine-guanine phosphoribosyltransferase
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: hpt, hprT, Rv3624c, MTCY15C10.28
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5knpa_
  • Chain 'B':
    Compound: hypoxanthine-guanine phosphoribosyltransferase
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: hpt, hprT, Rv3624c, MTCY15C10.28
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5knpb_
  • Chain 'C':
    Compound: hypoxanthine-guanine phosphoribosyltransferase
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: hpt, hprT, Rv3624c, MTCY15C10.28
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5knpc_
  • Chain 'D':
    Compound: hypoxanthine-guanine phosphoribosyltransferase
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: hpt, hprT, Rv3624c, MTCY15C10.28
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5knpd_
  • Heterogens: 6W7, MG, POP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5knpA (A:)
    hhhhhhhvtqsssaitpgqtaelypgdiksvlltaeqiqariaelgeqigndyrelsatt
    gqdlllitvlkgavlfvtdlaraipvptqfefmavssygsstsssgvvrilkdldrdihg
    rdvlivedvvdsgltlswlsrnltsrnprslrvctllrkpdavhanveiayvgfdipndf
    vvgygldyderyrdlsyigtldprvyq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5knpA (A:)
    elypgdiksvlltaeqiqariaelgeqigndyrelsattgqdlllitvlkgavlfvtdla
    raipvptqfefmavssygvvrilkdldrdihgrdvlivedvvdsgltlswlsrnltsrnp
    rslrvctllrkpdavhanveiayvgfdipndfvvgygldyderyrdlsyigtldprv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5knpB (B:)
    hhhhhhhvtqsssaitpgqtaelypgdiksvlltaeqiqariaelgeqigndyrelsatt
    gqdlllitvlkgavlfvtdlaraipvptqfefmavssygsstsssgvvrilkdldrdihg
    rdvlivedvvdsgltlswlsrnltsrnprslrvctllrkpdavhanveiayvgfdipndf
    vvgygldyderyrdlsyigtldprvyq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5knpB (B:)
    lypgdiksvlltaeqiqariaelgeqigndyrattgqdlllitvlkgavlfvtdlaraip
    vptqfefmavssyggvvrilkdldrdihgrdvlivedvvdsgltlswlsrnltsrnprsl
    rvctllrkpdavhanveiayvgfdipndfvvgygldyderyrdlsyigtldprvy
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5knpC (C:)
    hhhhhhhvtqsssaitpgqtaelypgdiksvlltaeqiqariaelgeqigndyrelsatt
    gqdlllitvlkgavlfvtdlaraipvptqfefmavssygsstsssgvvrilkdldrdihg
    rdvlivedvvdsgltlswlsrnltsrnprslrvctllrkpdavhanveiayvgfdipndf
    vvgygldyderyrdlsyigtldprvyq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5knpC (C:)
    elypgdiksvlltaeqiqariaelgeqigndyrettgqdlllitvlkgavlfvtdlarai
    pvptqfefmavssygsgvvrilkdldrdihgrdvlivedvvdsgltlswlsrnltsrnpr
    slrvctllrkpdavhanveiayvgfdipndfvvgygldyderyrdlsyigtldprvyq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5knpD (D:)
    hhhhhhhvtqsssaitpgqtaelypgdiksvlltaeqiqariaelgeqigndyrelsatt
    gqdlllitvlkgavlfvtdlaraipvptqfefmavssygsstsssgvvrilkdldrdihg
    rdvlivedvvdsgltlswlsrnltsrnprslrvctllrkpdavhanveiayvgfdipndf
    vvgygldyderyrdlsyigtldprvyq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5knpD (D:)
    elypgdiksvlltaeqiqariaelgeqigndyrelsattgqdlllitvlkgavlfvtdla
    raipvptqfefmavssygsgvvrilkdldrdihgrdvlivedvvdsgltlswlsrnltsr
    nprslrvctllrkpdavhanveiayvgfdipndfvvgygldyderyrdlsyigtldprvy
    q