PDB entry 5knh

View 5knh on RCSB PDB site
Description: crystal structure of darpin 6g9 in complex with cyno il-13
Deposited on 2016-06-28, released 2016-12-14
The last revision was dated 2017-01-11, with a file datestamp of 2017-01-06.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'D':
    Compound: darpin 6g9
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 5KNH
  • Chain 'I':
    Compound: il13
    Species: Macaca fascicularis [TaxId:9541]
    Gene: IL13
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ACT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5knhD (D:)
    mrgshhhhhhgsdldkklleaaragqddevrilmangadvnardsygstplhlaareghl
    eivevllkygadvnaadfigdtplhlaayrghleivevllkygadvnasditgetplhla
    aqighleivevllkhgadvnaqdkfgktpadiaadnghediaevlqkln
    

    Sequence, based on observed residues (ATOM records):
    >5knhD (D:)
    sdldkklleaaragqddevrilmangadvnardsygstplhlaareghleivevllkyga
    dvnaadfigdtplhlaayrghleivevllkygadvnasditgetplhlaaqighleivev
    llkhgadvnaqdkfgktpadiaadnghediaevlqkl
    

  • Chain 'I':
    Sequence, based on SEQRES records:
    >5knhI (I:)
    gpvppstalkelieelvnitqnqkaplcngsmvwsinltagvycaaleslinvsgcsaie
    ktqrmlngfcphkvsagqfsslrvrdtkievaqfvkdllvhlkklfregqfn
    

    Sequence, based on observed residues (ATOM records):
    >5knhI (I:)
    vppstalkelieelvnitqnqkaplcngsmvwsinltagvycaaleslinvsgcsaiekt
    qrmlngfcphdtkievaqfvkdllvhlkklfregqfn