PDB entry 5kne

View 5kne on RCSB PDB site
Description: cryoem reconstruction of hsp104 hexamer
Deposited on 2016-06-28, released 2016-07-27
The last revision was dated 2019-11-27, with a file datestamp of 2019-11-22.
Experiment type: EM
Resolution: 5.64 Å
R-factor: N/A
AEROSPACI score: -0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heat shock protein 104
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: HSP104, YLL026W, L0948
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Heat shock protein 104
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: HSP104, YLL026W, L0948
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Heat shock protein 104
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: HSP104, YLL026W, L0948
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Heat shock protein 104
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: HSP104, YLL026W, L0948
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Heat shock protein 104
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: HSP104, YLL026W, L0948
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Heat shock protein 104
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: HSP104, YLL026W, L0948
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ANP

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5kneA (A:)
    qfteraltiltlaqklasdhqhpqlqpihilaafietpedgsvpylqnliekgrydydlf
    kkvvnrnlvripqqqpapaeitpsyalgkvlqdaakiqkqqkdsfiaqdhilfalfndss
    iqqifkeaqvdieaikqqalelrgntridsrgadtntpleylskyaidmteqarqgkldp
    vigreeeirstirvlarriksnpcligepgigktaiiegvaqriidddvptilqgaklfs
    ldlaaltagakykgdfeerfkgvlkeieesktlivlfideihmlmgngkddaanilkpal
    srgqlkvigattnneyrsivekdgaferrfqkievaepsvrqtvailrglqpkyeihhgv
    rildsalvtaaqlakrylpyrrlpdsaldlvdiscagvavardskpeeldskerqlqliq
    veikalerdedadsttkdrlklarqkeaslqeeleplrqryneekhgheeltqakkklde
    lenkaldaerrydtataadlryfaipdikkqiekledqvaeeerragansmiqnvvdsdt
    isetaarltgipvkklseseneklihmerdlssevvgqmdaikavsnavrlsrsglanpr
    qpasflflglsgsgktelakkvagflfndedmmirvdcselsekyavskllgttagyvgy
    deggfltnqlqykpysvllfdevekahpdvltvmlqmlddgritsgqgktidcsncivim
    tsnlgaefinsqqgskiqestknlvmgavrqhfrpeflnrissivifnklsrkaihkivd
    irlkeieerfeqndkhyklnltqeakdflakygysddmgarplnrliqneilnklalril
    kneikdketvnv
    

    Sequence, based on observed residues (ATOM records):
    >5kneA (A:)
    eylskyaidmteqarqgkldpvigreeeirstirvlarriksnpcligepgigktaiieg
    vaqriidddvptilqgaklfsldlaaltgdfeerfkgvlkeieesktlivlfideihmlm
    gdaanilkpalsrgqlkvigattnneyrsivekdgaferrfqkievaepsvrqtvailrg
    lqpkyeihhgvrildsalvtaaqlakrylpyrrlpdsaldlvdiscagvavardssmiqn
    vvdsdtisetaarltgipvkklseseneklihmerdlssevvgqmdaikavsnavrlsrs
    glanprqpasflflglsgsgktelakkvagflfndedmmirvdcselsekyavskllgtt
    ydeggfltnqlqykpysvllfdevekahpdvltvmlqmlddgritsgqgktidcsncivi
    mtsnlgaefinsqqgskiqestknlvmgavrqhfrpeflnrissivifnklsrkaihkiv
    dirlkeieerfeqndkhyklnltqeakdflakygysddmgarplnrliqneilnklalri
    lkneikdketvnv
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5kneB (B:)
    qfteraltiltlaqklasdhqhpqlqpihilaafietpedgsvpylqnliekgrydydlf
    kkvvnrnlvripqqqpapaeitpsyalgkvlqdaakiqkqqkdsfiaqdhilfalfndss
    iqqifkeaqvdieaikqqalelrgntridsrgadtntpleylskyaidmteqarqgkldp
    vigreeeirstirvlarriksnpcligepgigktaiiegvaqriidddvptilqgaklfs
    ldlaaltagakykgdfeerfkgvlkeieesktlivlfideihmlmgngkddaanilkpal
    srgqlkvigattnneyrsivekdgaferrfqkievaepsvrqtvailrglqpkyeihhgv
    rildsalvtaaqlakrylpyrrlpdsaldlvdiscagvavardskpeeldskerqlqliq
    veikalerdedadsttkdrlklarqkeaslqeeleplrqryneekhgheeltqakkklde
    lenkaldaerrydtataadlryfaipdikkqiekledqvaeeerragansmiqnvvdsdt
    isetaarltgipvkklseseneklihmerdlssevvgqmdaikavsnavrlsrsglanpr
    qpasflflglsgsgktelakkvagflfndedmmirvdcselsekyavskllgttagyvgy
    deggfltnqlqykpysvllfdevekahpdvltvmlqmlddgritsgqgktidcsncivim
    tsnlgaefinsqqgskiqestknlvmgavrqhfrpeflnrissivifnklsrkaihkivd
    irlkeieerfeqndkhyklnltqeakdflakygysddmgarplnrliqneilnklalril
    kneikdketvnv
    

    Sequence, based on observed residues (ATOM records):
    >5kneB (B:)
    qfteraltiltlaqklasdhqhpqlqpihilaafietpedgsvpylqnliekgrydydlf
    kkvvnrnlvripqqqpapaeitpsyalgkvlqdaakiqkqqkdsfiaqdhilfalfndss
    iqqifkeaqvdieaikqqalelrgntridsrgadtntpleylskyaidmteqarqgkldp
    vigreeeirstirvlarriksnpcligepgigktaiiegvaqriidddvptilqgaklfs
    ldlaaltgdfeerfkgvlkeieesktlivlfideihmlmgaanilkpalsrgqlkvigat
    tnneyrsivekdgaferrfqkievaepsvrqtvailrglqpkyeihhgvrildsalvtaa
    qlakrylpyrrlpdsaldlvdiscagvavardssmiqnvvdsdtisetaarltgipvkkl
    seseneklihmerdlssevvgqmdaikavsnavrlsrsglanprqpasflflglsgsgkt
    elakkvagflfndedmmirvdcselsekyavskllgttydeggfltnqlqykpysvllfd
    evekahpdvltvmlqmlddgritsgqgktidcsncivimtsnlgaefinsqqgskiqest
    knlvmgavrqhfrpeflnrissivifnklsrkaihkivdirlkeieerfeqndkhyklnl
    tqeakdflakygysddmgarplnrliqneilnklalrilkneikdketvnv
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5kneC (C:)
    qfteraltiltlaqklasdhqhpqlqpihilaafietpedgsvpylqnliekgrydydlf
    kkvvnrnlvripqqqpapaeitpsyalgkvlqdaakiqkqqkdsfiaqdhilfalfndss
    iqqifkeaqvdieaikqqalelrgntridsrgadtntpleylskyaidmteqarqgkldp
    vigreeeirstirvlarriksnpcligepgigktaiiegvaqriidddvptilqgaklfs
    ldlaaltagakykgdfeerfkgvlkeieesktlivlfideihmlmgngkddaanilkpal
    srgqlkvigattnneyrsivekdgaferrfqkievaepsvrqtvailrglqpkyeihhgv
    rildsalvtaaqlakrylpyrrlpdsaldlvdiscagvavardskpeeldskerqlqliq
    veikalerdedadsttkdrlklarqkeaslqeeleplrqryneekhgheeltqakkklde
    lenkaldaerrydtataadlryfaipdikkqiekledqvaeeerragansmiqnvvdsdt
    isetaarltgipvkklseseneklihmerdlssevvgqmdaikavsnavrlsrsglanpr
    qpasflflglsgsgktelakkvagflfndedmmirvdcselsekyavskllgttagyvgy
    deggfltnqlqykpysvllfdevekahpdvltvmlqmlddgritsgqgktidcsncivim
    tsnlgaefinsqqgskiqestknlvmgavrqhfrpeflnrissivifnklsrkaihkivd
    irlkeieerfeqndkhyklnltqeakdflakygysddmgarplnrliqneilnklalril
    kneikdketvnv
    

    Sequence, based on observed residues (ATOM records):
    >5kneC (C:)
    qfteraltiltlaqklasdhqhpqlqpihilaafietpedgsvpylqnliekgrydydlf
    kkvvnrnlvripqqqpapaeitpsyalgkvlqdaakiqkqqkdsfiaqdhilfalfndss
    iqqifkeaqvdieaikqqalelrgntridsrgadtntpleylskyaidmteqarqgkldp
    vigreeeirstirvlarriksnpcligepgigktaiiegvaqriidddvptilqgaklfs
    ldlaaltgdfeerfkgvlkeieesktlivlfideihmlmgnaanilkpalsrgqlkviga
    ttnneyrsivekdgaferrfqkievaepsvrqtvailrglqpkyeihhgvrildsalvta
    aqlakrylpyrrlpdsaldlvdiscagvavardskpeeldskerqlqliqveikalerde
    dadsttkdrlklarqkeaslqeeleplrqrynsmiqnvvdsdtisetaarltgipvkkls
    eseneklihmerdlssevvgqmdaikavsnavrlsrsglanprqpasflflglsgsgkte
    lakkvagflfndedmmirvdcselsekyavskllgttdeggfltnqlqykpysvllfdev
    ekahpdvltvmlqmlddgritsgqgktidcsncivimtsnlgaefinsqqgskiqestkn
    lvmgavrqhfrpeflnrissivifnklsrkaihkivdirlkeieerfeqndkhyklnltq
    eakdflakygysddmgarplnrliqneilnklalrilkneikdketvnv
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5kneD (D:)
    qfteraltiltlaqklasdhqhpqlqpihilaafietpedgsvpylqnliekgrydydlf
    kkvvnrnlvripqqqpapaeitpsyalgkvlqdaakiqkqqkdsfiaqdhilfalfndss
    iqqifkeaqvdieaikqqalelrgntridsrgadtntpleylskyaidmteqarqgkldp
    vigreeeirstirvlarriksnpcligepgigktaiiegvaqriidddvptilqgaklfs
    ldlaaltagakykgdfeerfkgvlkeieesktlivlfideihmlmgngkddaanilkpal
    srgqlkvigattnneyrsivekdgaferrfqkievaepsvrqtvailrglqpkyeihhgv
    rildsalvtaaqlakrylpyrrlpdsaldlvdiscagvavardskpeeldskerqlqliq
    veikalerdedadsttkdrlklarqkeaslqeeleplrqryneekhgheeltqakkklde
    lenkaldaerrydtataadlryfaipdikkqiekledqvaeeerragansmiqnvvdsdt
    isetaarltgipvkklseseneklihmerdlssevvgqmdaikavsnavrlsrsglanpr
    qpasflflglsgsgktelakkvagflfndedmmirvdcselsekyavskllgttagyvgy
    deggfltnqlqykpysvllfdevekahpdvltvmlqmlddgritsgqgktidcsncivim
    tsnlgaefinsqqgskiqestknlvmgavrqhfrpeflnrissivifnklsrkaihkivd
    irlkeieerfeqndkhyklnltqeakdflakygysddmgarplnrliqneilnklalril
    kneikdketvnv
    

    Sequence, based on observed residues (ATOM records):
    >5kneD (D:)
    qfteraltiltlaqklasdhqhpqlqpihilaafietpedgsvpylqnliekgrydydlf
    kkvvnrnlvripqqqpapaeitpsyalgkvlqdaakiqkqqkdsfiaqdhilfalfndss
    iqqifkeaqvdieaikqqalelrgntridsrgadtntpleylskyaidmteqarqgkldp
    vigreeeirstirvlarriksnpcligepgigktaiiegvaqriidddvptilqgaklfs
    ldlaalgdfeerfkgvlkeieesktlivlfideihmlmgnaanilkpalsrgqlkvigat
    tnneyrsivekdgaferrfqkievaepsvrqtvailrglqpkyeihhgvrildsalvtaa
    qlakrylpyrrlpdsaldlvdiscagvavardskpeeldskerqlqliqveikalerded
    adsttkdrlklarqkeaslqeeleplrqrynsmiqnvvdsdtisetaarltgipvkklse
    seneklihmerdlssevvgqmdaikavsnavrlsrsglanprqpasflflglsgsgktel
    akkvagflfndedmmirvdcselsekyavskllgttaydeggfltnqlqykpysvllfde
    vekahpdvltvmlqmlddgritsgqgktidcsncivimtsnlgaefinsqqgskiqestk
    nlvmgavrqhfrpeflnrissivifnklsrkaihkivdirlkeieerfeqndkhyklnlt
    qeakdflakygysddmgarplnrliqneilnklalrilkneikdketvnv
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >5kneE (E:)
    qfteraltiltlaqklasdhqhpqlqpihilaafietpedgsvpylqnliekgrydydlf
    kkvvnrnlvripqqqpapaeitpsyalgkvlqdaakiqkqqkdsfiaqdhilfalfndss
    iqqifkeaqvdieaikqqalelrgntridsrgadtntpleylskyaidmteqarqgkldp
    vigreeeirstirvlarriksnpcligepgigktaiiegvaqriidddvptilqgaklfs
    ldlaaltagakykgdfeerfkgvlkeieesktlivlfideihmlmgngkddaanilkpal
    srgqlkvigattnneyrsivekdgaferrfqkievaepsvrqtvailrglqpkyeihhgv
    rildsalvtaaqlakrylpyrrlpdsaldlvdiscagvavardskpeeldskerqlqliq
    veikalerdedadsttkdrlklarqkeaslqeeleplrqryneekhgheeltqakkklde
    lenkaldaerrydtataadlryfaipdikkqiekledqvaeeerragansmiqnvvdsdt
    isetaarltgipvkklseseneklihmerdlssevvgqmdaikavsnavrlsrsglanpr
    qpasflflglsgsgktelakkvagflfndedmmirvdcselsekyavskllgttagyvgy
    deggfltnqlqykpysvllfdevekahpdvltvmlqmlddgritsgqgktidcsncivim
    tsnlgaefinsqqgskiqestknlvmgavrqhfrpeflnrissivifnklsrkaihkivd
    irlkeieerfeqndkhyklnltqeakdflakygysddmgarplnrliqneilnklalril
    kneikdketvnv
    

    Sequence, based on observed residues (ATOM records):
    >5kneE (E:)
    eylskyaidmteqarqgkldpvigreeeirstirvlarriksnpcligepgigktaiieg
    vaqriidddvptilqgaklfsldlaalgdfeerfkgvlkeieesktlivlfideihmlmg
    naanilkpalsrgqlkvigattnneyrsivekdgaferrfqkievaepsvrqtvailrgl
    qpkyeihhgvrildsalvtaaqlakrylpyrrlpdsaldlvdiscagvavardskpeeld
    skerqlqliqveikalerdedadsttkdrlklarqkeaslqeeleplrqrynsmiqnvvd
    sdtisetaarltgipvkklseseneklihmerdlssevvgqmdaikavsnavrlsrsgla
    nprqpasflflglsgsgktelakkvagflfndedmmirvdcselsekyavskllgttyde
    ggfltnqlqykpysvllfdevekahpdvltvmlqmlddgritsgqgktidcsncivimts
    nlgaefinsqqgskiqestknlvmgavrqhfrpeflnrissivifnklsrkaihkivdir
    lkeieerfeqndkhyklnltqeakdflakygysddmgarplnrliqneilnklalrilkn
    eikdketvnv
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >5kneF (F:)
    qfteraltiltlaqklasdhqhpqlqpihilaafietpedgsvpylqnliekgrydydlf
    kkvvnrnlvripqqqpapaeitpsyalgkvlqdaakiqkqqkdsfiaqdhilfalfndss
    iqqifkeaqvdieaikqqalelrgntridsrgadtntpleylskyaidmteqarqgkldp
    vigreeeirstirvlarriksnpcligepgigktaiiegvaqriidddvptilqgaklfs
    ldlaaltagakykgdfeerfkgvlkeieesktlivlfideihmlmgngkddaanilkpal
    srgqlkvigattnneyrsivekdgaferrfqkievaepsvrqtvailrglqpkyeihhgv
    rildsalvtaaqlakrylpyrrlpdsaldlvdiscagvavardskpeeldskerqlqliq
    veikalerdedadsttkdrlklarqkeaslqeeleplrqryneekhgheeltqakkklde
    lenkaldaerrydtataadlryfaipdikkqiekledqvaeeerragansmiqnvvdsdt
    isetaarltgipvkklseseneklihmerdlssevvgqmdaikavsnavrlsrsglanpr
    qpasflflglsgsgktelakkvagflfndedmmirvdcselsekyavskllgttagyvgy
    deggfltnqlqykpysvllfdevekahpdvltvmlqmlddgritsgqgktidcsncivim
    tsnlgaefinsqqgskiqestknlvmgavrqhfrpeflnrissivifnklsrkaihkivd
    irlkeieerfeqndkhyklnltqeakdflakygysddmgarplnrliqneilnklalril
    kneikdketvnv
    

    Sequence, based on observed residues (ATOM records):
    >5kneF (F:)
    eylskyaidmteqarqgkldpvigreeeirstirvlarriksnpcligepgigktaiieg
    vaqriidddvptilqgaklfsldlaalgdfeerfkgvlkeieesktlivlfideihmlma
    anilkpalsrgqlkvigattnneyrsivekdgaferrfqkievaepsvrqtvailrglqp
    kyeihhgvrildsalvtaaqlakrylpyrrlpdsaldlvdiscagvavardskpeeldsk
    erqlqliqveikalerdedadsttkdrlklarqkeaslqeeleplrqrynsmiqnvvdsd
    tisetaarltgipvkklseseneklihmerdlssevvgqmdaikavsnavrlsrsglanp
    rqpasflflglsgsgktelakkvagflfndedmmirvdcselsekyavskllgttdeggf
    ltnqlqykpysvllfdevekahpdvltvmlqmlddgritsgqgktidcsncivimtsnlg
    aefinsqqgskiqestknlvmgavrqhfrpeflnrissivifnklsrkaihkivdirlke
    ieerfeqndkhyklnltqeakdflakygysddmgarplnrliqneilnklalrilkneik
    dketvnv