PDB entry 5kn7

View 5kn7 on RCSB PDB site
Description: lipid a secondary acyltransferase lpxm from acinetobacter baumannii
Deposited on 2016-06-27, released 2016-09-28
The last revision was dated 2016-10-26, with a file datestamp of 2016-10-21.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: Lipid A biosynthesis lauroyl acyltransferase
    Species: Acinetobacter baumannii NIPH 410 [TaxId:1217634]
    Gene: F910_00940
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, NA, GOL, LMT, PO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5kn7B (B:)
    mhhhhhhtrpdsksmnyqllktfsrqpiqfgrflarllaglvntlkitrtsksielnlri
    alpyltpqqriaitekavrneltsyfeflsiwgssnsknisrihriegehffhealaakk
    gvvlivphfgtwevmnawcaqftsmtilykpvknadadrfvrearsreqanlvptdesgv
    rqifkalkqgettvilpdhtpnvggdmvnyfgvplassnlsakliqktkakalflyairn
    endgftmhiepmdekiyegtaddgtyvihqaieqliyqypehyhwsykrfkanpaldniy
    nidptealkivdrlkaealktstqpepiqtsvm
    

    Sequence, based on observed residues (ATOM records):
    >5kn7B (B:)
    mnyqllktfsrqpiqfgrflarllaglvntlkitrtsksielnlrialpyltpqqriait
    ekavrneltsyfeflsiwgssnsknisrihriegehffhealaakkgvvlivphfgtwev
    mnawcaqftsmtilykpvknadadrfvrearsreqanlvptdesgvrqifkalkqgettv
    ilpdhtpnvggdmvnyfgvplassnlsakliqktkakalflyairnendgftmhiepmde
    kiyegtaddgtyvihqaieqliyqypehyhwsykrfkanpaldniynidptealkivdrl
    kaealktstqpepiqtsvm