PDB entry 5kn0

View 5kn0 on RCSB PDB site
Description: native bovine skeletal calsequestrin, low-ca2+ form
Deposited on 2016-06-27, released 2016-10-05
The last revision was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.73 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calsequestrin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: calsequestrin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: calsequestrin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: calsequestrin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG, CA, MPD, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5kn0A (A:)
    eegldfpeydgvdrvvnvnaknyknvfkkyevlallyheppeddkasqrqfemdelilel
    aaqvledkgvgfgmvdsekdaavakklglteedsvyvfkgdevieydgefsadtlvefll
    dvledpveliegerelqafenieddnkligyfknkdsehykayedaaeefhpyipffatf
    dskvakkltlklneidfyeafmeepvtipdkpnseeeivsfveahkrstlrklkpesmye
    tweddldgihivafaeetdpdgyefletlkavaqdntdnpdlsiiwidpddfpllvpywe
    ktfnidlsapqigvvnvtdadsvwmemddeedlpsaeeledwledvlegeintedddeed
    d
    

    Sequence, based on observed residues (ATOM records):
    >5kn0A (A:)
    gldfpeydgvdrvvnvnaknyknvfkkyevlallyheppeddkasqrqfemdelilelaa
    qvledkgvgfgmvdsekdaavakklglteedsvyvfkgdevieydgefsadtlveflldv
    ledpveliegerelqafenieddnkligyfknkdsehykayedaaeefhpyipffatfds
    kvakkltlklneidfyeafmeepvtipdkpnseeeivsfveahkrstlrklkpesmyetw
    eddldgihivafaeetdpdgyefletlkavaqdntdnpdlsiiwidpddfpllvpywekt
    fnidlsapqigvvnvtdadsvwmemddeedlpsaeeledwledvle
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5kn0B (B:)
    eegldfpeydgvdrvvnvnaknyknvfkkyevlallyheppeddkasqrqfemdelilel
    aaqvledkgvgfgmvdsekdaavakklglteedsvyvfkgdevieydgefsadtlvefll
    dvledpveliegerelqafenieddnkligyfknkdsehykayedaaeefhpyipffatf
    dskvakkltlklneidfyeafmeepvtipdkpnseeeivsfveahkrstlrklkpesmye
    tweddldgihivafaeetdpdgyefletlkavaqdntdnpdlsiiwidpddfpllvpywe
    ktfnidlsapqigvvnvtdadsvwmemddeedlpsaeeledwledvlegeintedddeed
    d
    

    Sequence, based on observed residues (ATOM records):
    >5kn0B (B:)
    gldfpeydgvdrvvnvnaknyknvfkkyevlallyheppeddkasqrqfemdelilelaa
    qvledkgvgfgmvdsekdaavakklglteedsvyvfkgdevieydgefsadtlveflldv
    ledpveliegerelqafenieddnkligyfknkdsehykayedaaeefhpyipffatfds
    kvakkltlklneidfyeafmeepvtipdkpnseeeivsfveahkrstlrklkpesmyetw
    eddldgihivafaeetdpdgyefletlkavaqdntdnpdlsiiwidpddfpllvpywekt
    fnidlsapqigvvnvtdadsvwmemddeedlpsaeeledwledvle
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5kn0C (C:)
    eegldfpeydgvdrvvnvnaknyknvfkkyevlallyheppeddkasqrqfemdelilel
    aaqvledkgvgfgmvdsekdaavakklglteedsvyvfkgdevieydgefsadtlvefll
    dvledpveliegerelqafenieddnkligyfknkdsehykayedaaeefhpyipffatf
    dskvakkltlklneidfyeafmeepvtipdkpnseeeivsfveahkrstlrklkpesmye
    tweddldgihivafaeetdpdgyefletlkavaqdntdnpdlsiiwidpddfpllvpywe
    ktfnidlsapqigvvnvtdadsvwmemddeedlpsaeeledwledvlegeintedddeed
    d
    

    Sequence, based on observed residues (ATOM records):
    >5kn0C (C:)
    ldfpeydgvdrvvnvnaknyknvfkkyevlallyheppeddkasqrqfemdelilelaaq
    vledkgvgfgmvdsekdaavakklglteedsvyvfkgdevieydgefsadtlveflldvl
    edpveliegerelqafenieddnkligyfknkdsehykayedaaeefhpyipffatfdsk
    vakkltlklneidfyeafmeepvtipdkpnseeeivsfveahkrstlrklkpesmyetwe
    ddldgihivafaeetdpdgyefletlkavaqdntdnpdlsiiwidpddfpllvpywektf
    nidlsapqigvvnvtdadsvwmemddeedlpsaeeledwledvle
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5kn0D (D:)
    eegldfpeydgvdrvvnvnaknyknvfkkyevlallyheppeddkasqrqfemdelilel
    aaqvledkgvgfgmvdsekdaavakklglteedsvyvfkgdevieydgefsadtlvefll
    dvledpveliegerelqafenieddnkligyfknkdsehykayedaaeefhpyipffatf
    dskvakkltlklneidfyeafmeepvtipdkpnseeeivsfveahkrstlrklkpesmye
    tweddldgihivafaeetdpdgyefletlkavaqdntdnpdlsiiwidpddfpllvpywe
    ktfnidlsapqigvvnvtdadsvwmemddeedlpsaeeledwledvlegeintedddeed
    d
    

    Sequence, based on observed residues (ATOM records):
    >5kn0D (D:)
    gldfpeydgvdrvvnvnaknyknvfkkyevlallyheppeddkasqrqfemdelilelaa
    qvledkgvgfgmvdsekdaavakklglteedsvyvfkgdevieydgefsadtlveflldv
    ledpveliegerelqafenieddnkligyfknkdsehykayedaaeefhpyipffatfds
    kvakkltlklneidfyeafmeepvtipdkpnseeeivsfveahkrstlrklkpesmyetw
    eddldgihivafaeetdpdgyefletlkavaqdntdnpdlsiiwidpddfpllvpywekt
    fnidlsapqigvvnvtdadsvwmemddeedlpsaeeledwledvle