PDB entry 5kmx

View 5kmx on RCSB PDB site
Description: structure of trypanosoma congolense insect stage antigen
Deposited on 2016-06-27, released 2017-07-05
The last revision was dated 2020-01-08, with a file datestamp of 2020-01-03.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative uncharacterized protein TCIL3000_10_9440
    Species: Trypanosoma congolense [TaxId:1068625]
    Gene: TCIL3000_10_9440
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Putative uncharacterized protein TCIL3000_10_9440
    Species: Trypanosoma congolense [TaxId:1068625]
    Gene: TCIL3000_10_9440
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Putative uncharacterized protein TCIL3000_10_9440
    Species: Trypanosoma congolense [TaxId:1068625]
    Gene: TCIL3000_10_9440
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Putative uncharacterized protein TCIL3000_10_9440
    Species: Trypanosoma congolense [TaxId:1068625]
    Gene: TCIL3000_10_9440
    Database cross-references and differences (RAF-indexed):
  • Chain 'U':
    Compound: Putative uncharacterized protein TCIL3000_10_9440
    Species: Trypanosoma congolense [TaxId:1068625]
    Gene: TCIL3000_10_9440
    Database cross-references and differences (RAF-indexed):
    • PDB 5KMX (0-13)
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5kmxA (A:)
    gsamgssdeprddfkeavnafnpnpiekwtgrfntenasvrrrtlnvpgfksiptvytea
    tlplnkdvtdgrltvvvnintvqpftrrtplrvkrekwytcsssqcsgssskcdchrkhd
    efrnkciseggryttesskcrlgekcgyckqnvylatlylvagsvgggmyresdkyqsal
    ypfydisqgyeprqpssvnvrlysegdpfiafqqltegreefgipnrtvgaaa
    

    Sequence, based on observed residues (ATOM records):
    >5kmxA (A:)
    prddfkeavnafnpnpiekwtgrfntenasvrrrtlnvpgfksiptvyteatlplnkdvt
    dgrltvvvnintvqpftrrtplrvkrekwytcssschrkhdefrnkciseggryttessk
    crlgekcgyckqnvylatlylvagsvgggmyresdkyqsalypfydisqgyeprqpssvn
    vrlysegdpfiafqqltegree
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5kmxB (B:)
    gsamgssdeprddfkeavnafnpnpiekwtgrfntenasvrrrtlnvpgfksiptvytea
    tlplnkdvtdgrltvvvnintvqpftrrtplrvkrekwytcsssqcsgssskcdchrkhd
    efrnkciseggryttesskcrlgekcgyckqnvylatlylvagsvgggmyresdkyqsal
    ypfydisqgyeprqpssvnvrlysegdpfiafqqltegreefgipnrtvgaaa
    

    Sequence, based on observed residues (ATOM records):
    >5kmxB (B:)
    dfkeavnafnpnpiekwtgrfntenasvrrrtiptvyteatlplnkdvtdgrltvvvnin
    tvqpftrrtplrvkrekwytcsssqcsgssskcdchrkhdefrnkciseggryttesskc
    rlgekcgyckqnvylatlylvagsvgggmyresdkyqsalypfydisqgyeprqpssvnv
    rlysegdpfiafqqlt
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5kmxC (C:)
    gsamgssdeprddfkeavnafnpnpiekwtgrfntenasvrrrtlnvpgfksiptvytea
    tlplnkdvtdgrltvvvnintvqpftrrtplrvkrekwytcsssqcsgssskcdchrkhd
    efrnkciseggryttesskcrlgekcgyckqnvylatlylvagsvgggmyresdkyqsal
    ypfydisqgyeprqpssvnvrlysegdpfiafqqltegreefgipnrtvgaaa
    

    Sequence, based on observed residues (ATOM records):
    >5kmxC (C:)
    rddfkeavnpnpiekwtgrfntenasvrvyteatlplnkdvtdgrltvvvnintvqpftr
    rtplrvkrekwytcsssqccdchrkhdefrnkciseggryttesskcrlgekcgyckqnv
    ylatlylvagsvgggmyresdkyqsalypfydisqgyeprqpssvnvrlysegdpfiafq
    ql
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5kmxD (D:)
    gsamgssdeprddfkeavnafnpnpiekwtgrfntenasvrrrtlnvpgfksiptvytea
    tlplnkdvtdgrltvvvnintvqpftrrtplrvkrekwytcsssqcsgssskcdchrkhd
    efrnkciseggryttesskcrlgekcgyckqnvylatlylvagsvgggmyresdkyqsal
    ypfydisqgyeprqpssvnvrlysegdpfiafqqltegreefgipnrtvgaaa
    

    Sequence, based on observed residues (ATOM records):
    >5kmxD (D:)
    eavnafnpnpiekwtgrfntenasvrrrttvyteatlplnkdvtdgrltvvvnintvqpf
    trrtplrvkrekwytcsssqcsskcdchrkhdefrnkciseggryttskcrlgekcgyck
    qnvylatlylvagsvgmyresdkyqsalypfydisqgyeprqpssvnvrlysegdpfiaf
    qqlt
    

  • Chain 'U':
    Sequence; same for both SEQRES and ATOM records:
    >5kmxU (U:)
    xxxxxxxxxxxxxx