PDB entry 5kmv

View 5kmv on RCSB PDB site
Description: crystal structure of crenezumab fab
Deposited on 2016-06-27, released 2017-01-04
Made obsolete by 5vzx on 2017-08-09

The last revision was dated 2017-08-09, with a file datestamp of 2017-08-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: IgG4 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5KMV (0-End)
  • Chain 'H':
    Compound: IgG4 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5KMV (0-End)
  • Chain 'I':
    Compound: IgG4 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5KMV (0-218)
  • Chain 'L':
    Compound: IgG4 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5KMV (0-End)
  • Heterogens: SO4, MES, EPE, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'E':
    Sequence, based on SEQRES records:
    >5kmvE (E:)
    evqlvesggglvqpggslrlscaasgftfssygmswvrqapgkglelvasinsnggstyy
    pdsvkgrftisrdnaknslylqmnslraedtavyycasgdywgqgtlvtvssastkgpsv
    fplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssv
    vtvpssslgtqtyicnvnhkpsntkvdkkvepkscdktht
    

    Sequence, based on observed residues (ATOM records):
    >5kmvE (E:)
    evqlvesggglvqpggslrlscaasgftfssygmswvrqapgkglelvasinsnggstyy
    pdsvkgrftisrdnaknslylqmnslraedtavyycasgdywgqgtlvtvssastkgpsv
    fplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssv
    vtvpssslgtqtyicnvnhkpsntkvdkkvepks
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >5kmvH (H:)
    evqlvesggglvqpggslrlscaasgftfssygmswvrqapgkglelvasinsnggstyy
    pdsvkgrftisrdnaknslylqmnslraedtavyycasgdywgqgtlvtvssastkgpsv
    fplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssv
    vtvpssslgtqtyicnvnhkpsntkvdkkvepkscdktht
    

    Sequence, based on observed residues (ATOM records):
    >5kmvH (H:)
    evqlvesggglvqpggslrlscaasgftfssygmswvrqapgkglelvasinsnggstyy
    pdsvkgrftisrdnaknslylqmnslraedtavyycasgdywgqgtlvtvssastkgpsv
    fplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssv
    vtvpssslgtqtyicnvnhkpsntkvdkkvepks
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records:
    >5kmvI (I:)
    divmtqsplslpvtpgepasiscrssqslvysngdtylhwylqkpgqspqlliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedvgvyycsqsthvpwtfgqgtkveikrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'L':
    Sequence, based on SEQRES records:
    >5kmvL (L:)
    divmtqsplslpvtpgepasiscrssqslvysngdtylhwylqkpgqspqlliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedvgvyycsqsthvpwtfgqgtkveikrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records):
    >5kmvL (L:)
    divmtqsplslpvtpgepasiscrssqslvysngdtylhwylqkpgqspqlliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedvgvyycsqsthvpwtfgqgtkveikrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrge