PDB entry 5kml

View 5kml on RCSB PDB site
Description: TrkA JM-kinase with 1-(5-methyl-3-phenyl-1,2-oxazol-4-yl)-3-[[2-(trifluoromethyl)phenyl]methyl]urea
Class: transferase/transferase inhibitor
Keywords: kinase, juxtamembrane, inhibitor, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2016-06-27, released 2016-12-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-02-01, with a file datestamp of 2017-01-26.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: high affinity nerve growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: NTRK1, MTC, TRK, TRKA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5kmla1
  • Heterogens: 6UH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5kmlA (A:)
    sslsptegkgsglqghiienpqyfsdacvhhikrrdivlkwelgegafgkvflaechnll
    peqdkmlvavkalkeasesarqdfqreaelltmlqhqhivrffgvctegrpllmvfeymr
    hgdlnrflrshgpdakllaggedvapgplglgqllavasqvaagmvylaglhfvhrdlat
    rnclvgqglvvkigdfgmsrdiystdyyrvggrtmlpirwmppesilyrkfttesdvwsf
    gvvlweiftygkqpwyqlsnteaidcitqgrelerpracppevyaimrgcwqrepqqrhs
    ikdvharlqalaqappvyldvlghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kmlA (A:)
    sslsptdacvhhikrrdivlkwelgegafgkvflaechnllpdkmlvavkalkesesarq
    dfqreaelltmlqhqhivrffgvctegrpllmvfeymrhgdlnrflrshgpdagedvapg
    plglgqllavasqvaagmvylaglhfvhrdlatrnclvgqglvvkigdfgmsrdiystdy
    yrvggrtmlpirwmppesilyrkfttesdvwsfgvvlweiftygkqpwyqlsnteaidci
    tqgrelerpracppevyaimrgcwqrepqqrhsikdvharlqalaqappvyldvlg