PDB entry 5kmh

View 5kmh on RCSB PDB site
Description: structure of cavab in complex with br-verapamil
Deposited on 2016-06-27, released 2016-08-31
The last revision was dated 2019-12-04, with a file datestamp of 2019-11-29.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ion transport protein
    Species: Arcobacter butzleri (strain RM4018) [TaxId:367737]
    Gene: Abu_1752
    Database cross-references and differences (RAF-indexed):
    • Uniprot A8EVM5 (18-End)
      • conflict (194-195)
      • conflict (198)
  • Chain 'B':
    Compound: Ion transport protein
    Species: Arcobacter butzleri (strain RM4018) [TaxId:367737]
    Gene: Abu_1752
    Database cross-references and differences (RAF-indexed):
    • Uniprot A8EVM5 (18-End)
      • conflict (194-195)
      • conflict (198)
  • Chain 'C':
    Compound: Ion transport protein
    Species: Arcobacter butzleri (strain RM4018) [TaxId:367737]
    Gene: Abu_1752
    Database cross-references and differences (RAF-indexed):
    • Uniprot A8EVM5 (18-End)
      • conflict (194-195)
      • conflict (198)
  • Chain 'D':
    Compound: Ion transport protein
    Species: Arcobacter butzleri (strain RM4018) [TaxId:367737]
    Gene: Abu_1752
    Database cross-references and differences (RAF-indexed):
    • Uniprot A8EVM5 (18-End)
      • conflict (194-195)
      • conflict (198)
  • Heterogens: CA, MC3, PX6, 6U8

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5kmhA (A:)
    mdykddddkgslvprgshmylritnivessfftkfiiylivlngitmgletsktfmqsfg
    vyttlfnqivitiftieiilriyvhrisffkdpwslfdffvvaislvptssgfeilrvlr
    vlrlfrlvtavpqmrkivsalisvipgmlsvialmtlffyifaimatqlfgerfpewfgt
    lgesfytlfqvmtlddwsngivrplmevypyawvffipfifvvtfvminlvvaiivdama
    ilnqkeeqhiidevqshedninneiiklreeivelkeliktslkn
    

    Sequence, based on observed residues (ATOM records):
    >5kmhA (A:)
    mylritnivessfftkfiiylivlngitmgletsktfmqsfgvyttlfnqivitiftiei
    ilriyvhrisffkdpwslfdffvvaislvptssgfeilrvlrvlrlfrlvtavpqmrkiv
    salisvipgmlsvialmtlffyifaimatqlfgerfpewfgtlgesfytlfqvmtlddws
    ngivrplmevypyawvffipfifvvtfvminlvvaiivd
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5kmhB (B:)
    mdykddddkgslvprgshmylritnivessfftkfiiylivlngitmgletsktfmqsfg
    vyttlfnqivitiftieiilriyvhrisffkdpwslfdffvvaislvptssgfeilrvlr
    vlrlfrlvtavpqmrkivsalisvipgmlsvialmtlffyifaimatqlfgerfpewfgt
    lgesfytlfqvmtlddwsngivrplmevypyawvffipfifvvtfvminlvvaiivdama
    ilnqkeeqhiidevqshedninneiiklreeivelkeliktslkn
    

    Sequence, based on observed residues (ATOM records):
    >5kmhB (B:)
    mylritnivessfftkfiiylivlngitmgletsktfmqsfgvyttlfnqivitiftiei
    ilriyvhrisffkdpwslfdffvvaislvptssgfeilrvlrvlrlfrlvtavpqmrkiv
    salisvipgmlsvialmtlffyifaimatqlfgerfpewfgtlgesfytlfqvmtlddws
    ngivrplmevypyawvffipfifvvtfvminlvvaiivd
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5kmhC (C:)
    mdykddddkgslvprgshmylritnivessfftkfiiylivlngitmgletsktfmqsfg
    vyttlfnqivitiftieiilriyvhrisffkdpwslfdffvvaislvptssgfeilrvlr
    vlrlfrlvtavpqmrkivsalisvipgmlsvialmtlffyifaimatqlfgerfpewfgt
    lgesfytlfqvmtlddwsngivrplmevypyawvffipfifvvtfvminlvvaiivdama
    ilnqkeeqhiidevqshedninneiiklreeivelkeliktslkn
    

    Sequence, based on observed residues (ATOM records):
    >5kmhC (C:)
    mylritnivessfftkfiiylivlngitmgletsktfmqsfgvyttlfnqivitiftiei
    ilriyvhrisffkdpwslfdffvvaislvptssgfeilrvlrvlrlfrlvtavpqmrkiv
    salisvipgmlsvialmtlffyifaimatqlfgerfpewfgtlgesfytlfqvmtlddws
    ngivrplmevypyawvffipfifvvtfvminlvvaiivd
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5kmhD (D:)
    mdykddddkgslvprgshmylritnivessfftkfiiylivlngitmgletsktfmqsfg
    vyttlfnqivitiftieiilriyvhrisffkdpwslfdffvvaislvptssgfeilrvlr
    vlrlfrlvtavpqmrkivsalisvipgmlsvialmtlffyifaimatqlfgerfpewfgt
    lgesfytlfqvmtlddwsngivrplmevypyawvffipfifvvtfvminlvvaiivdama
    ilnqkeeqhiidevqshedninneiiklreeivelkeliktslkn
    

    Sequence, based on observed residues (ATOM records):
    >5kmhD (D:)
    mylritnivessfftkfiiylivlngitmgletsktfmqsfgvyttlfnqivitiftiei
    ilriyvhrisffkdpwslfdffvvaislvptssgfeilrvlrvlrlfrlvtavpqmrkiv
    salisvipgmlsvialmtlffyifaimatqlfgerfpewfgtlgesfytlfqvmtlddws
    ngivrplmevypyawvffipfifvvtfvminlvvaiivd