PDB entry 5klv

View 5klv on RCSB PDB site
Description: Structure of bos taurus cytochrome bc1 with fenamidone inhibited
Class: oxidoreductase
Keywords: mitochondrial respiratory chain, cytochrome bc1 complex, fenamidone, electron transfer, OXIDOREDUCTASE
Deposited on 2016-06-25, released 2016-10-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-07, with a file datestamp of 2016-12-02.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome b-c1 complex subunit 1, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5klva1, d5klva2
  • Chain 'B':
    Compound: Cytochrome b-c1 complex subunit 2, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5klvb1, d5klvb2
  • Chain 'C':
    Compound: cytochrome b
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5klvc1, d5klvc2
  • Chain 'D':
    Compound: Cytochrome c1, heme protein, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5klvd1, d5klvd2
  • Chain 'E':
    Compound: Cytochrome b-c1 complex subunit Rieske, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5klve1, d5klve2
  • Chain 'F':
    Compound: Cytochrome b-c1 complex subunit 7
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Cytochrome b-c1 complex subunit 8
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5klvg_
  • Chain 'H':
    Compound: cytochrome b-c1 complex subunit 6, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5klvh_
  • Chain 'I':
    Compound: Cytochrome b-c1 complex subunit Rieske, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: Cytochrome b-c1 complex subunit 9
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5klvj_
  • Chain 'K':
    Compound: cytochrome b-c1 complex subunit 10
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5klvk_
  • Heterogens: 6PE, CDL, GOL, HEM, FNM, 8PE, CL, HEC, PEF, FES, PX4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5klvA (A:)
    tatyaqalqsvpetqvsqldnglrvaseqssqptctvgvwidagsryeseknngagyfve
    hlafkgtknrpgnalekevesmgahlnaystrehtayyikalskdlpkavelladivqnc
    sledsqiekerdvilqelqendtsmrdvvfnylhatafqgtplaqsvegpsenvrklsra
    dlteylsrhykaprmvlaaagglehrqlldlaqkhfsglsgtydedavptlspcrftgsq
    ichredglplahvaiavegpgwahpdnvalqvanaiighydctygggahlssplasiaat
    nklcqsfqtfnicyadtgllgahfvcdhmsiddmmfvlqgqwmrlctsatesevlrgknl
    lrnalvshldgttpvcedigrslltygrriplaewesriaevdarvvrevcskyfydqcp
    avagfgpieqlpdynrirsgmfwlrf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5klvB (B:)
    slkvapkvkateapagvpphpqdleftrlpnglviaslenyapasriglfikagsryens
    nnlgtshllrlasslttkgassfkitrgieavggklsvtstrenmaytveclrddvdilm
    efllnvttapefrrwevaalqpqlridkavalqnpqahvienlhaaayrnalanslycpd
    yrigkvtpvelhdyvqnhftsarmaliglgvshpvlkqvaeqflnirgglglsgakakyh
    ggeireqngdslvhaalvaesaaigsaeanafsvlqhvlgagphvkrgsnatsslyqava
    kgvhqpfdvsafnasysdsglfgfytisqaasagdvikaaynqvktiaqgnlsnpdvqaa
    knklkagylmsvessegfldevgsqalaagsytppstvlqqidavadadvinaakkfvsg
    rksmaasgnlghtpfidel
    

    Sequence, based on observed residues (ATOM records): (download)
    >5klvB (B:)
    agvpphpqdleftrlpnglviaslenyapasriglfikagsryensnnlgtshllrlass
    lttkgassfkitrgieavggklsvtstrenmaytveclrddvdilmefllnvttapefrr
    wevaalqpqlridkavalqnpqahvienlhaaayrnalanslycpdyrigkvtpvelhdy
    vqnhftsarmaliglgvshpvlkqvaeqflnirgglglsgakakyhggeireqngdslvh
    aalvaesaaigsaeanafsvlqhvlgagphvkrgsnatsslyqavakgvhqpfdvsafna
    sysdsglfgfytisqaasagdvikaaynqvktiaqgnlsnpdvqaaknklkagylmsves
    segfldevgsqalaagsytppstvlqqidavadadvinaakkfvsgrksmaasgnlghtp
    fidel
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5klvC (C:)
    mtnirkshplmkivnnafidlpapsnisswwnfgsllgiclilqiltglflamhytsdtt
    tafssvthicrdvnygwiirymhangasmfficlymhvgrglyygsytfletwnigvill
    ltvmatafmgyvlpwgqmsfwgatvitnllsaipyigtnlvewiwggfsvdkatltrffa
    fhfilpfiimaiamvhllflhetgsnnptgissdvdkipfhpyytikdilgalllilalm
    llvlfapdllgdpdnytpanplntpphikpewyflfayailrsipnklggvlalafsili
    lalipllhtskqrsmmfrplsqclfwalvadlltltwiggqpvehpyitigqlasvlyfl
    lilvlmptagtienkllkw
    

    Sequence, based on observed residues (ATOM records): (download)
    >5klvC (C:)
    nirkshplmkivnnafidlpapsnisswwnfgsllgiclilqiltglflamhytsdttta
    fssvthicrdvnygwiirymhangasmfficlymhvgrglyygsytfletwnigvilllt
    vmatafmgyvlpwgqmsfwgatvitnllsaipyigtnlvewiwggfsvdkatltrffafh
    filpfiimaiamvhllflhetgsnnptgissdvdkipfhpyytikdilgalllilalmll
    vlfapdllgdpdnytpanplntpphikpewyflfayailrsipnklggvlalafsilila
    lipllhtskqrsmmfrplsqclfwalvadlltltwiggqpvehpyitigqlasvlyflli
    lvlmptagtienkllkw
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5klvD (D:)
    sdlelhppsypwshrgllssldhtsirrgfqvykqvcsschsmdyvayrhlvgvcytede
    akalaeevevqdgpnedgemfmrpgklsdyfpkpypnpeaaraanngalppdlsyivrar
    hggedyvfslltgycepptgvslreglyfnpyfpgqaigmappiynevlefddgtpatms
    qvakdvctflrwaaepehdhrkrmglkmllmmglllplvyamkrhkwsvlksrklayrpp
    k
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5klvE (E:)
    shtdikvpdfsdyrrpevldstksskessearkgfsylvtatttvgvayaaknvvsqfvs
    smsasadvlamskieiklsdipegknmafkwrgkplfvrhrtkkeidqeaavevsqlrdp
    qhdlervkkpewviligvcthlgcvpianagdfggyycpchgshydasgrirkgpaplnl
    evpsyeftsddmvivg
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5klvG (G:)
    grqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvyt
    wgtqefekskrknpaayend
    

    Sequence, based on observed residues (ATOM records): (download)
    >5klvG (G:)
    grqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvyt
    wgtqefekskrknpa
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5klvH (H:)
    gdpkeeeeeeeelvdplttvreqceqlekcvkarerlelcdervssrsqteedcteelld
    flhardhcvahklfnslk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5klvH (H:)
    elvdplttvreqceqlekcvkarerlelcdervssrsqteedcteelldflhardhcvah
    klfnslk
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5klvJ (J:)
    vaptltarlysllfrrtstfaltivvgalfferafdqgadaiyehinegklwkhikhkye
    nke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5klvJ (J:)
    vaptltarlysllfrrtstfaltivvgalfferafdqgadaiyehinegklwkhikhkye
    n
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >5klvK (K:)
    ltrflgpryrqlarnwvptaslwgavgavglvwatdwrlildwvpyingkfkkdd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5klvK (K:)
    ltrflgpryrqlarnwvptaslwgavgavglvwatdwrlildwvpyingk