PDB entry 5klu

View 5klu on RCSB PDB site
Description: Crystal Structure of a Domain-swapped Dimer of Yeast Iso-1-cytochrome c with omega-undecylenyl-beta-D-maltopyranoside
Class: electron transport
Keywords: Electron Transport Apoptosis Lipid Binding, ELECTRON TRANSPORT
Deposited on 2016-06-25, released 2017-03-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-03-10, with a file datestamp of 2021-03-05.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Cytochrome c iso-1
  Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
  Gene: CYC1, YJR048W, J1653
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00044 (Start-105)
    • engineered mutation (74)
    • engineered mutation (104)
  Domains in SCOPe 2.08: d5klua_
• Chain 'B':
  Compound: Cytochrome c iso-1
  Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
  Gene: CYC1, YJR048W, J1653
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00044 (0-105)
    • engineered mutation (74)
    • engineered mutation (104)
  Domains in SCOPe 2.08: d5klub_
• Heterogens: HEC, 6UZ, SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >5kluA (A:)
  fkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikknv
  lwdennmseyltnpakyipgtkmafgglkkekdrndlitylkkase
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >5kluA (A:)
  gsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikknvlwd
  ennmseyltnpakyipgtkmafgglkkekdrndlitylkkase
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5kluB (B:)
  fkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikknv
  lwdennmseyltnpakyipgtkmafgglkkekdrndlitylkkase