PDB entry 5kl2

View 5kl2 on RCSB PDB site
Description: wilms tumor protein (wt1) znf2-4 in complex with dna
Deposited on 2016-06-23, released 2016-09-14
The last revision was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Wilms tumor protein
    Species: Homo sapiens [TaxId:9606]
    Gene: WT1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: DNA (5'-d(*ap*gp*cp*gp*tp*gp*gp*gp*ap*gp*t)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'C':
    Compound: DNA (5'-d(*tp*ap*cp*tp*cp*cp*cp*ap*cp*gp*c)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Heterogens: EDO, ZN, NA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5kl2A (A:)
    gplgsekpyqcdfkdcerrfsrsdqlkrhqrrhtgvkpfqcktcqrkfsrsdhlkthtrt
    htgekpfscrwpscqkkfarsdelvrhhnmhqr
    

    Sequence, based on observed residues (ATOM records):
    >5kl2A (A:)
    ekpyqcdfkdcerrfsrsdqlkrhqrrhtgvkpfqcktcqrkfsrsdhlkthtrthtgek
    pfscrwpscqkkfarsdelvrhhnmhqr
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.