PDB entry 5kkx

View 5kkx on RCSB PDB site
Description: Crystal structure of a TbpB C-lobe mutant from Neisseria meningitidis M982
Class: transferrin-binding protein
Keywords: Lipoprotein, transferrin receptor, iron acquisition, vaccine candidate, TRANSFERRIN-BINDING PROTEIN
Deposited on 2016-06-23, released 2017-07-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-07-19, with a file datestamp of 2017-07-14.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TbpB
    Species: Neisseria meningitidis [TaxId:487]
    Database cross-references and differences (RAF-indexed):
    • PDB 5KKX
    Domains in SCOPe 2.06: d5kkxa1, d5kkxa2
  • Chain 'B':
    Compound: TbpB
    Species: Neisseria meningitidis [TaxId:487]
    Database cross-references and differences (RAF-indexed):
    • PDB 5KKX
    Domains in SCOPe 2.06: d5kkxb1, d5kkxb2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5kkxA (A:)
    sklttvldaveltlndkkiknldnfsnaaqlvvdgimidlagteftrkfehtingktyev
    evccsnlnylkygmltrkgkqveqsmflqgertdekeiptdqnvvyrgswyghiangtsw
    sgnasdkeggnraeftvnfadkkitgkltaenrqaqtftiegmiqgngfegtaktaesgf
    dldqknttrtpkayitdakvkggfygpkaeelggwfayhksdngsatvvfgakrqqpvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kkxA (A:)
    tvldaveltlndkkiknldnfsnaaqlvvdgimidlaeftrkfehtingktyevevccsn
    lnylkygmltrkgkqveqsmflqgertdekeiptdqnvvyrgswyghiangtswsgnasd
    keggnraeftvnfadkkitgkltaenrqaqtftiegmiqgngfegtaktaesgfdldqkn
    trtpkayitdakvkggfygpkaeelggwfayhksdngsatvvfgakrqqp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5kkxB (B:)
    sklttvldaveltlndkkiknldnfsnaaqlvvdgimidlagteftrkfehtingktyev
    evccsnlnylkygmltrkgkqveqsmflqgertdekeiptdqnvvyrgswyghiangtsw
    sgnasdkeggnraeftvnfadkkitgkltaenrqaqtftiegmiqgngfegtaktaesgf
    dldqknttrtpkayitdakvkggfygpkaeelggwfayhksdngsatvvfgakrqqpvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kkxB (B:)
    ttvldaveltlndkkiknldnfsnaaqlvvdgimidlaeftrkfehtingktyevevccs
    nlnylkygmltrkgkqveqsmflqgertdekeiptdqnvvyrgswyghiangtswsgnas
    dkeggnraeftvnfadkkitgkltaenrqaqtftiegmiqgngfegtaktaesgfdldqk
    nttrtpkayitdakvkggfygpkaeelggwfayhksdngsatvvfgakrqqp