PDB entry 5kkw

View 5kkw on RCSB PDB site
Description: Crystal structure of SAR11_1068 bound to a sulfobetaine (3-(1-methylpiperidinium-1-yl)propane-1-sulfonate)
Class: lyase
Keywords: Solute-binding protein, periplasmic binding protein, transport protein, LYASE
Deposited on 2016-06-22, released 2017-07-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cyclohexadienyl dehydratase
    Species: Pelagibacter ubique (strain HTCC1062) [TaxId:335992]
    Gene: pheC, SAR11_1068
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4FLR5 (Start-247)
      • expression tag (248)
    Domains in SCOPe 2.07: d5kkwa1, d5kkwa2
  • Heterogens: KH2, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5kkwA (A:)
    mrgshhhhhhiaeskldqilssgelkvgttgdwdpmamkdpatnkykgfdidvmqelakd
    mgvkitfvptewktivsgitagrydistsvtktpkraevagftdsyykygtvplvlkknl
    kkystwkslnnkdvtiattlgtsqeekakeffplsklqsvespardfqevlagradgnit
    ssteanklvvkypqlaivpdgeknpaflammvskndqvwndyvnewikskkssgffnkll
    akynlksll
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kkwA (A:)
    eskldqilssgelkvgttgdwdpmamkdpatnkykgfdidvmqelakdmgvkitfvptew
    ktivsgitagrydistsvtktpkraevagftdsyykygtvplvlkknlkkystwkslnnk
    dvtiattlgtsqeekakeffplsklqsvespardfqevlagradgnitssteanklvvky
    pqlaivpdgeknpaflammvskndqvwndyvnewikskkssgffnkllakynlksll