PDB entry 5kkt

View 5kkt on RCSB PDB site
Description: rock 1 bound to azaindole thiazole piperazine inhibitor
Deposited on 2016-06-22, released 2017-06-28
The last revision was dated 2018-07-11, with a file datestamp of 2018-07-06.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Rho-associated protein kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ROCK1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Rho-associated protein kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ROCK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13464 (5-End)
      • cloning artifact (4)
  • Heterogens: 6U2, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5kktA (A:)
    gslhmsfetrfekmdnllrdpksevnsdclldgldalvydldfpalrknknidnflsryk
    dtinkirdlrmkaedyevvkvigrgafgevqlvrhkstrkvyamkllskfemikrsdsaf
    fweerdimafanspwvvqlfyafqddrylymvmeympggdlvnlmsnydvpekwarfyta
    evvlaldaihsmgfihrdvkpdnmlldksghlkladfgtcmkmnkegmvrcdtavgtpdy
    ispevlksqggdgyygrecdwwsvgvflyemlvgdtpfyadslvgtyskimnhknsltfp
    ddndiskeaknlicafltdrevrlgrngveeikrhlffkndqwawetlrdtvapvvpdls
    sdidtsnfddleedkgeeetfpipkafvgnqlpfvgftyysnrrylssanpndnr
    

    Sequence, based on observed residues (ATOM records):
    >5kktA (A:)
    sfetrfekmdnllrdpksevnsdclldgldalvydldfpalrknknidnflsrykdtink
    irdlrmkaedyevvkvigrgafgevqlvrhkstrkvyamkllskfemikaffweerdima
    fanspwvvqlfyafqddrylymvmeympggdlvnlmsnydvpekwarfytaevvlaldai
    hsmgfihrdvkpdnmlldksghlkladfgtcmkmnkegmvrcdtavgtpdyispevlksq
    ggdgyygrecdwwsvgvflyemlvgdtpfyadslvgtyskimnhknsltfpddndiskea
    knlicafltdrevrlgrngveeikrhlffkndqwawetlrdtvapvvpdlssdidtsnfd
    dletfpipkafvgnqlpfvgftyysnrry
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5kktB (B:)
    gslhmsfetrfekmdnllrdpksevnsdclldgldalvydldfpalrknknidnflsryk
    dtinkirdlrmkaedyevvkvigrgafgevqlvrhkstrkvyamkllskfemikrsdsaf
    fweerdimafanspwvvqlfyafqddrylymvmeympggdlvnlmsnydvpekwarfyta
    evvlaldaihsmgfihrdvkpdnmlldksghlkladfgtcmkmnkegmvrcdtavgtpdy
    ispevlksqggdgyygrecdwwsvgvflyemlvgdtpfyadslvgtyskimnhknsltfp
    ddndiskeaknlicafltdrevrlgrngveeikrhlffkndqwawetlrdtvapvvpdls
    sdidtsnfddleedkgeeetfpipkafvgnqlpfvgftyysnrrylssanpndnr
    

    Sequence, based on observed residues (ATOM records):
    >5kktB (B:)
    msfetrfekmdnllrdpksevnsdclldgldalvydldfpalrknknidnflsrykdtin
    kirdlrmkaedyevvkvigrgafgevqlvrhkstrkvyamkllskfemikrsdsaffwee
    rdimafanspwvvqlfyafqddrylymvmeympggdlvnlmsnydvpekwarfytaevvl
    aldaihsmgfihrdvkpdnmlldksghlkladfgtcmkmnkegmvrcdtavgtpdyispe
    vlksqggdgyygrecdwwsvgvflyemlvgdtpfyadslvgtyskimnhknsltfpddnd
    iskeaknlicafltdrevrlgrngveeikrhlffkndqwawetlrdtvapvvpdlssdid
    tsnfddlgeeetfpipkafvgnqlpfvgftyysn