PDB entry 5kkk

View 5kkk on RCSB PDB site
Description: 1.7-Angstrom In situ Mylar structure of sperm whale myoglobin (SWMb-CO) at 100 K
Class: oxygen transport
Keywords: oxygen transport
Deposited on 2016-06-21, released 2017-02-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-02-15, with a file datestamp of 2017-02-10.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Gene: MB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (0-153)
      • engineered mutation (122)
    Domains in SCOPe 2.07: d5kkka_
  • Heterogens: HEM, CMO, SO4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5kkkA (A:)
    mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
    dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
    pgnfgadaqgamnkalelfrkdiaakykelgyqg