PDB entry 5kkk

View 5kkk on RCSB PDB site
Description: 1.7-Angstrom In situ Mylar structure of sperm whale myoglobin (SWMb-CO) at 100 K
Class: oxygen transport
Keywords: oxygen transport
Deposited on 2016-06-21, released 2017-02-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-05-16, with a file datestamp of 2018-05-11.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Myoglobin
  Species: Physeter catodon [TaxId:9755]
  Gene: MB
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02185 (0-153)
    • engineered mutation (122)
  Domains in SCOPe 2.08: d5kkka_
• Heterogens: HEM, CMO, SO4, CL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5kkkA (A:)
  mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
  dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
  pgnfgadaqgamnkalelfrkdiaakykelgyqg