PDB entry 5kke

View 5kke on RCSB PDB site
Description: Crystal Structure of a Domain-swapped Dimer of Yeast Iso-1-cytochrome c with CYMAL5
Class: electron transport
Keywords: Electron Transport Apoptosis Lipid Binding, ELECTRON TRANSPORT
Deposited on 2016-06-21, released 2017-03-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-03-10, with a file datestamp of 2021-03-05.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Cytochrome c iso-1
  Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
  Gene: CYC1, YJR048W, J1653
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00044 (0-107)
    • engineered mutation (76)
    • engineered mutation (106)
  Domains in SCOPe 2.08: d5kkea_
• Heterogens: HEC, SO4, CM5, CL, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5kkeA (A:)
  tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
  nvlwdennmseyltnpakyipgtkmafgglkkekdrndlitylkkase