PDB entry 5kke

View 5kke on RCSB PDB site
Description: Crystal Structure of a Domain-swapped Dimer of Yeast Iso-1-cytochrome c with CYMAL5
Class: electron transport
Keywords: Electron Transport Apoptosis Lipid Binding, ELECTRON TRANSPORT
Deposited on 2016-06-21, released 2017-03-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-03-22, with a file datestamp of 2017-03-17.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c iso-1
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: CYC1, YJR048W, J1653
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00044 (0-107)
      • engineered mutation (76)
      • engineered mutation (106)
    Domains in SCOPe 2.07: d5kkea_
  • Heterogens: HEM, SO4, CM5, CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5kkeA (A:)
tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
nvlwdennmseyltnpakyipgtkmafgglkkekdrndlitylkkase