PDB entry 5kkb

View 5kkb on RCSB PDB site
Description: Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex
Class: sugar binding protein
Keywords: Alpha/alpha barrel, Golgi apparatus, deglycosylation, glycan substrate analog, SUGAR BINDING PROTEIN
Deposited on 2016-06-21, released 2016-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA
    Species: Mus musculus [TaxId:10090]
    Gene: Man1a1, Man1a
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5kkba_
  • Chain 'B':
    Compound: Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA
    Species: Mus musculus [TaxId:10090]
    Gene: Man1a1, Man1a
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5kkbb_
  • Heterogens: BMA, MAN, NAG, LA, 1PS, BU1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5kkbA (A:)
    vdflppvgvenrepadatirekrakikemmthawnnykryawglnelkpiskeghssslf
    gnikgativdaldtlfimgmktefqeakswikkyldfnvnaevsvfevnirfvggllsay
    ylsgeeifrkkavelgvkllpafhtpsgipwallnmksgigrnwpwasggssilaefgtl
    hlefmhlshlsgdpvfaekvmkirtvlnkldkpeglypnylnpssgqwgqhhvsvgglgd
    sfyeyllkawlmsdktdleakkmyfdavqaiethlirkssggltyiaewkggllehkmgh
    ltcfaggmfalgadgapearaqhylelgaeiartchesynrtyvklgpeafrfdggveai
    atrqnekyyilrpevietymymwrlthdpkyrtwaweavealeshcrvnggysglrdvyi
    aresyddvqqsfflaetlkylylifsdddllplehwifnteahpfpilr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5kkbB (B:)
    vdflppvgvenrepadatirekrakikemmthawnnykryawglnelkpiskeghssslf
    gnikgativdaldtlfimgmktefqeakswikkyldfnvnaevsvfevnirfvggllsay
    ylsgeeifrkkavelgvkllpafhtpsgipwallnmksgigrnwpwasggssilaefgtl
    hlefmhlshlsgdpvfaekvmkirtvlnkldkpeglypnylnpssgqwgqhhvsvgglgd
    sfyeyllkawlmsdktdleakkmyfdavqaiethlirkssggltyiaewkggllehkmgh
    ltcfaggmfalgadgapearaqhylelgaeiartchesynrtyvklgpeafrfdggveai
    atrqnekyyilrpevietymymwrlthdpkyrtwaweavealeshcrvnggysglrdvyi
    aresyddvqqsfflaetlkylylifsdddllplehwifnteahpfpilr