PDB entry 5kjz

View 5kjz on RCSB PDB site
Description: Co-crystal structure of PKA RI alpha CNB-B mutant (G316R/A336T) with cGMP
Class: signaling protein
Keywords: Cyclic nucleotide, cAMP-dependent protein kinase, nucleotide selectivity, cyclic nucleotide binding domain, SIGNALING PROTEIN
Deposited on 2016-06-20, released 2017-06-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-dependent protein kinase type I-alpha regulatory subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: PRKAR1A, PKR1, PRKAR1, TSE1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10644 (2-149)
      • expression tag (1)
      • engineered mutation (84)
      • engineered mutation (104)
    Domains in SCOPe 2.07: d5kjza1, d5kjza2
  • Heterogens: PCG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5kjzA (A:)
    gsilmgstlrkrkmyeeflskvsilesldkwerltvadalepvqfedgqkivvqgepgde
    ffiilegsaavlqrrseneefvevrrlgpsdyfgeiallmnrprtatvvargplkcvkld
    rprfervlgpcsdilkrniqqynsfvslsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kjzA (A:)
    silmgstlrkrkmyeeflskvsilesldkwerltvadalepvqfedgqkivvqgepgdef
    fiilegsaavlqrrseneefvevrrlgpsdyfgeiallmnrprtatvvargplkcvkldr
    prfervlgpcsdilkrniqqynsfvslsv