PDB entry 5kjt

View 5kjt on RCSB PDB site
Description: crystal structure of arabidopsis thaliana hct in complex with p- coumaroyl-coa
Deposited on 2016-06-20, released 2016-11-02
The last revision was dated 2019-11-20, with a file datestamp of 2019-11-15.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Shikimate O-hydroxycinnamoyltransferase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: HST, HCT, At5g48930, K19E20.4
    Database cross-references and differences (RAF-indexed):
  • Heterogens: WCA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5kjtA (A:)
    mkinirdstmvrpatetpitnlwnsnvdlviprfhtpsvyfyrptgasnffdpqvmkeal
    skalvpfypmagrlkrdddgrieidcngagvlfvvadtpsviddfgdfaptlnlrqlipe
    vdhsagihsfpllvlqvtffkcggaslgvgmqhhaadgfsglhfintwsdmargldltip
    pfidrtllrardppqpafhhveyqpapsmkipldpsksgpenttvsifkltrdqlvalka
    kskedgntvsyssyemlaghvwrsvgkarglpndqetklyiatdgrsrlrpqlppgyfgn
    viftatplavagdllskptwyaagqihdflvrmddnylrsaldylemqpdlsalvrgaht
    ykcpnlgitswvrlpiydadfgwgrpifmgpggipyeglsfvlpsptndgslsvaialqs
    ehmklfekflfei
    

    Sequence, based on observed residues (ATOM records):
    >5kjtA (A:)
    mkinirdstmvrpatetpitnlwnsnvdlviprfhtpsvyfyrptgasnffdpqvmkeal
    skalvpfypmagrlkrdddgrieidcngagvlfvvadtpsviddfgdfaptlnlrqlipe
    vdhsagihsfpllvlqvtffkcggaslgvgmqhhaadgfsglhfintwsdmargldltip
    pfidrtllrardppqpafhhveyqpapsmkipldpsksgpenttvsifkltrdqlvalka
    kskedgntvsyssyemlaghvwrsvgkarglpndqetklyiatdgrsrlrpqlppgyfgn
    viftatplavagdllskptwyaagqihdflvrmddnylrsaldylemqpdlsalvrgaht
    ykcpnlgitswvrlpiydadfgwgrpifmgpggipyeglsfvlpsptndgslsvaialqs
    ehmklfekflf