PDB entry 5kjo

View 5kjo on RCSB PDB site
Description: x-ray structure of pccel45a expressed in aspergillus nidullans
Deposited on 2016-06-20, released 2017-06-21
The last revision was dated 2020-01-01, with a file datestamp of 2019-12-27.
Experiment type: XRAY
Resolution: 1.47 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endoglucanase V-like protein
    Species: Phanerochaete chrysosporium [TaxId:5306]
    Gene: egv
    Database cross-references and differences (RAF-indexed):
  • Heterogens: EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >5kjoA (A:)
    atggyvqqatgqasftmysgcgspacgkaasgftaainqlafgsapglgagdacgrcfal
    tgnhdpyspnytgpfgqtivvkvtdlcpvqgnqefcgqttsnptnqhgmpfhfdicedtg
    gsakffpsghgaltgtftevscsqwsgsdggqlwngaclsgetapnwpstacgnkgtaps