PDB entry 5kjl

View 5kjl on RCSB PDB site
Description: smyd2 in complex with az378
Deposited on 2016-06-20, released 2016-12-07
The last revision was dated 2017-01-04, with a file datestamp of 2016-12-30.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N-lysine methyltransferase SMYD2
    Species: Homo sapiens [TaxId:9606]
    Gene: SMYD2, KMT3C
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NRG4 (Start-428)
      • engineered mutation (160)
  • Heterogens: SAM, ZN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5kjlA (A:)
    glgglerfcspgkgrglralqpfqvgdllfscpayayvltvnergnhceycftrkeglsk
    cgrckqafycnvecqkedwpmhklecspmvvfgenwnpsetvrltarilakqkihpertp
    sekllavkefeshldkldnekkdliqsdiaalhhfyskhlefpdndslvvlfaqvncngf
    tiedeelshlgsaifpdvalmnhsccpnvivtykgtlaevravqeikpgeevftsyidll
    yptedrndrlrdsyfftcecqecttkdkdkakveirklsdppkaeairdmvryarnviee
    frrakhykspselleicelsqekmssvfedsnvymlhmmyqamgvclymqdwegalqygq
    kiikpyskhyplyslnvasmwlklgrlymglehkaagekalkkaiaimevahgkdhpyis
    eikqeiesh
    

    Sequence, based on observed residues (ATOM records):
    >5kjlA (A:)
    lgglerfcspgkgrglralqpfqvgdllfscpayayvltvnergnhceycftrkeglskc
    grckqafycnvecqkedwpmhklecspmvvfgenwnpsetvrltarilakqkihpertps
    ekllavkefeshldkldnekkdliqsdiaalhhfyskhlefpdndslvvlfaqvncngft
    iedeelshlgsaifpdvalmnhsccpnvivtykgtlaevravqeikpgeevftsyidlly
    ptedrndrlrdsyfftcecqecttkdkdkakveirklsdppkaeairdmvryarnvieef
    rrakhykspselleicelsqekmssvfedsnvymlhmmyqamgvclymqdwegalqygqk
    iikpyskhyplyslnvasmwlklgrlymglehkaagekalkkaiaimevahgkdhpyise
    ikqeiesh