PDB entry 5kjh

View 5kjh on RCSB PDB site
Description: crystal structure of an active polycomb repressive complex 2 in the stimulated state
Deposited on 2016-06-20, released 2017-04-19
The last revision was dated 2017-04-19, with a file datestamp of 2017-04-14.
Experiment type: XRAY
Resolution: 2.27 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative polycomb protein Eed
    Species: Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) [TaxId:759272]
    Gene: CTHT_0029920
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Putative uncharacterized protein,Zinc finger domain-containing protein
    Species: Chaetomium thermophilum [TaxId:759272]
    Gene: CTHT_0006210
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Peptide H3K27me3
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5KJH
  • Heterogens: ZN, SAH, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5kjhA (A:)
    masawshpqfekgggsgggsggsawshpqfeklevlfqgpmpasdsaewelprlrtsfif
    qddykylgddgsvsqdlaeffdvkfypysppgappvfaatskkhavicrltqttdkdanp
    ceiiqlirddgneancascwskdpitdqpllciagnegnvkvynvtegklyrtlvghggg
    indlatspanpyiiasasddttiriwslapehekqpcvcilggeghsydllsvafhdngr
    yvlsaghdqvinlwalpefpnehmeipiviyyphfssseihnnlvdcvafygdlilsrac
    hedtivlwriegfssddpipgpldaptptdmtkqtrsyftptvspqsrpamftrlaqfht
    pdcgvqffmrfrmyhvpgkhpilafanaksktffwdlarfgeyarfmadlkeaqqsyngr
    vvvvdqgqgislaqaqqvhgpgvgvvmkpawlvpkrvkkapgaagsgsgtaangghnnnn
    nnnnnnnnnnhetgsqrsfsatnnlsnsgrdkesasmvsaspdpdspfgfsretlqawad
    mydlsnpvglikahrslaidgafvgrqvgwspegewcvvvgngnraliyqrwgkerglgs
    gtpga
    

    Sequence, based on observed residues (ATOM records):
    >5kjhA (A:)
    saewelprlrtsfifqddykylqdlaeffdvkfypysppgappvfaatskkhavicrltq
    ttdkdanpceiiqlirddgneancascwskdpitdqpllciagnegnvkvynvtegklyr
    tlvghgggindlatspanpyiiasasddttiriwslapehekqpcvcilggeghsydlls
    vafhdngryvlsaghdqvinlwalpefpnehmeipiviyyphfssseihnnlvdcvafyg
    dlilsrachedtivlwriegfssddpipgpldaptptdmtkqtrsyftptvspqsrpamf
    trlaqfhtpdcgvqffmrfrmyhvpgkhpilafanaksktffwdlarfgeyarfmadlke
    aqqsyngrvvvvdqgislaqaqqvhgpgvgvvmkpawlvpkvsaspdpdspfgfsretlq
    awadmydlsnpvglikahrslaidgafvgrqvgwspegewcvvvgngnraliyqrwgker
    g
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5kjhB (B:)
    snhhhhhhatpkntewtvdkiasalsvlaeevpqnhsrlvnflleetekrapqprhlskt
    dpfahmkskaidanrprpegvptmdvkfkqhsgeygksrnsgrrfqypvvcikpdrepvp
    pyrfhhaeirknilalnsqlnfvphlrdvdpnsaeeqkysawlmdlenldsksgfkiqpr
    sqkiakraqaeyaatlapylepwlrklniegctksnlirfmasqpesddsmtpqqksnll
    dtysddmgspqavrnasmfteawdrvfndqsklrrvalrdilmldknvepifdnkrakda
    pgsqkppdealmqkvidalgsyttlgclicfshdcehgeierdnqkrcfsleeigglmps
    lrrkwaaqieqrqkteggsanappahppcrnecyrihgtgdpnqqvppwsenevgtlewm
    fatigysqtlrpecfvgailgrpcwdvhrklqeldlrlppveprtipkqkslpwydrrkk
    qlmsdwadatithehavrelfapchhdgpctaangcpcasagthpvlcerfclctaeecp
    lkftgcachssgktclqrqregrpcicvqlnrecdptlckgcgareradpenaydevlhs
    tgcqnvalqrgaakavvlgksqleacgyglfaaedieegefvieytgelishdegvrreh
    rrgdvfdeenkvsylftlleqegiwvdaaiygnlsryinhatdgnimpkimyvnhewrik
    ftaikdikageelffnygdnfpnltkklverneqsgaettpqqpkranglvprgsevmlp
    grgvpkkplrrpkrrpllvpkttqplfdplskvqllpgqplpqhpiddswlllkhrdnlq
    dfidlrpeekeflqewdafilrrhisseqylpryflrfvrekadwlvskrsrgeefsklv
    atllarrvlpervvieatqvlndargrlreqggvieg
    

    Sequence, based on observed residues (ATOM records):
    >5kjhB (B:)
    wtvdkiasalsvlaeevpqnhsrlvnflleetekrapqprhlsktdpfahmkskaidanr
    prpegvptmdvkfkqhsgeygksrnsgrrfqypvvcikpdrepvppyrfhhaeirknila
    lnsqlnfvphlrdvdpnsaeeqkysawlmdlenldsksgfprsqkiakraqaeyaatlap
    ylepwlrklniectksnlirfmasqpetpqqksnlldtysddavrnasmfteawdrvfnd
    qrrvalrdilmldknvepifealmqkvidalgsyttlgclicfshdcehgeierdnqkrc
    fsleeigglmpslrrkwaaqieqppcrnecyihgtppwsenevgtlewmfatigyslrpe
    cfvgailrpcwdvhrklqeldlrlpipkqkslpwydrrkkqlmsdwadatithehavrel
    fapchhdgpctaangcpcasagthpvlcerfclctaeecplkftgcachssgktclqrqg
    rpcicvqlnrecdptlckgcgareradpenaydevlhstgcqnvalqrgaakavvlgksq
    leacgyglfaaedieegefvieytgelishdegvrrehrrgdvfdkvsylftlleqegiw
    vdaaiygnlsryinhatdgnimpkimyvnhewrikftaikdikageelffnygdnfpnlt
    kklevmlpgrgvppllvpkttqplfdplskvqllpgqplpqhpiddswlllkhrdnlqdf
    idlrpeekeflqewdafilrrhisseqylpryflrfvrekadwlvskrsrgeefsklvat
    llarrvlpervvieatqvlndargrlr
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5kjhD (D:)
    tkaarksapat
    

    Sequence, based on observed residues (ATOM records):
    >5kjhD (D:)
    kaarksap