PDB entry 5kjd

View 5kjd on RCSB PDB site
Description: Synechocystis apocarotenoid oxygenase (ACO) mutant - Glu150Gln
Class: oxidoreductase
Keywords: iron-coordination, active site, carotenoid binding, ligand interaction, non-heme iron, mutagenesis, OXIDOREDUCTASE
Deposited on 2016-06-18, released 2016-08-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Apocarotenoid-15,15'-oxygenase
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Gene: sll1541
    Database cross-references and differences (RAF-indexed):
    • Uniprot P74334 (Start-489)
      • engineered mutation (149)
    Domains in SCOPe 2.07: d5kjda_
  • Chain 'B':
    Compound: Apocarotenoid-15,15'-oxygenase
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Gene: sll1541
    Database cross-references and differences (RAF-indexed):
    • Uniprot P74334 (Start-489)
      • engineered mutation (149)
    Domains in SCOPe 2.07: d5kjdb_
  • Chain 'C':
    Compound: Apocarotenoid-15,15'-oxygenase
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Gene: sll1541
    Database cross-references and differences (RAF-indexed):
    • Uniprot P74334 (Start-489)
      • engineered mutation (149)
    Domains in SCOPe 2.07: d5kjdc_
  • Chain 'D':
    Compound: Apocarotenoid-15,15'-oxygenase
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Gene: sll1541
    Database cross-references and differences (RAF-indexed):
    • Uniprot P74334 (Start-489)
      • engineered mutation (149)
    Domains in SCOPe 2.07: d5kjdd_
  • Chain 'E':
    Compound: Apocarotenoid-15,15'-oxygenase
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Gene: sll1541
    Database cross-references and differences (RAF-indexed):
    • Uniprot P74334 (Start-489)
      • engineered mutation (149)
    Domains in SCOPe 2.07: d5kjde_
  • Heterogens: FE2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5kjdA (A:)
    mvtspptsspsqrsyspqdwlrgyqsqpqewdywvedvegsippdlqgtlyrngpgllei
    gdrplkhpfdgdgmvtafkfpgdgrvhfqskfvrtqgyveeqkagkmiyrgvfgsqpagg
    wlktifdlrlkniantnitywgdrllalwqggqphrlepsnlatiglddlggilaegqpl
    sahpridpastfdggqpcyvtfsiksslsstltlleldpqgkllrqktetfpgfafihdf
    aitphyaiflqnnvtlnglpylfglrgagecvqfhpdkpaqiilvprdggeikripvqag
    fvfhhanafeengkiildsicynslpqvdtdgdfrstnfdnldpgqlwrftidpaaatve
    kqlmvsrccefpvvhpqqvgrpyryvymgaahhstgnaplqailkvdlesgtetlrsfap
    hgfagepifvprpggvaeddgwllcliykadlhrselvildaqditapaiatlklkhhip
    yplhgswaqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kjdA (A:)
    qrsyspqdwlrgyqsqpqewdywvedvegsippdlqgtlyrngpglleigdrplkhpfdg
    dgmvtafkfpgdgrvhfqskfvrtqgyveeqkagkmiyrgvfgsqpaggwlktifdlrlk
    niantnitywgdrllalwqggqphrlepsnlatiglddlggilaegqplsahpridpast
    fdggqpcyvtfsiksslsstltlleldpqgkllrqktetfpgfafihdfaitphyaiflq
    nnvtlnglpylfglrgagecvqfhpdkpaqiilvprdggeikripvqagfvfhhanafee
    ngkiildsicynslpqvdtdgdfrstnfdnldpgqlwrftidpaaatvekqlmvsrccef
    pvvhpqqvgrpyryvymgaahhstgnaplqailkvdlesgtetlrsfaphgfagepifvp
    rpggvaeddgwllcliykadlhrselvildaqditapaiatlklkhhipyplhgswaqt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5kjdB (B:)
    mvtspptsspsqrsyspqdwlrgyqsqpqewdywvedvegsippdlqgtlyrngpgllei
    gdrplkhpfdgdgmvtafkfpgdgrvhfqskfvrtqgyveeqkagkmiyrgvfgsqpagg
    wlktifdlrlkniantnitywgdrllalwqggqphrlepsnlatiglddlggilaegqpl
    sahpridpastfdggqpcyvtfsiksslsstltlleldpqgkllrqktetfpgfafihdf
    aitphyaiflqnnvtlnglpylfglrgagecvqfhpdkpaqiilvprdggeikripvqag
    fvfhhanafeengkiildsicynslpqvdtdgdfrstnfdnldpgqlwrftidpaaatve
    kqlmvsrccefpvvhpqqvgrpyryvymgaahhstgnaplqailkvdlesgtetlrsfap
    hgfagepifvprpggvaeddgwllcliykadlhrselvildaqditapaiatlklkhhip
    yplhgswaqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kjdB (B:)
    qrsyspqdwlrgyqsqpqewdywvedvegsippdlqgtlyrngpglleigdrplkhpfdg
    dgmvtafkfpgdgrvhfqskfvrtqgyveeqkagkmiyrgvfgsqpaggwlktifdlrlk
    niantnitywgdrllalwqggqphrlepsnlatiglddlggilaegqplsahpridpast
    fdggqpcyvtfsiksslsstltlleldpqgkllrqktetfpgfafihdfaitphyaiflq
    nnvtlnglpylfglrgagecvqfhpdkpaqiilvprdggeikripvqagfvfhhanafee
    ngkiildsicynslpqvdtdgdfrstnfdnldpgqlwrftidpaaatvekqlmvsrccef
    pvvhpqqvgrpyryvymgaahhstgnaplqailkvdlesgtetlrsfaphgfagepifvp
    rpggvaeddgwllcliykadlhrselvildaqditapaiatlklkhhipyplhgswaqt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5kjdC (C:)
    mvtspptsspsqrsyspqdwlrgyqsqpqewdywvedvegsippdlqgtlyrngpgllei
    gdrplkhpfdgdgmvtafkfpgdgrvhfqskfvrtqgyveeqkagkmiyrgvfgsqpagg
    wlktifdlrlkniantnitywgdrllalwqggqphrlepsnlatiglddlggilaegqpl
    sahpridpastfdggqpcyvtfsiksslsstltlleldpqgkllrqktetfpgfafihdf
    aitphyaiflqnnvtlnglpylfglrgagecvqfhpdkpaqiilvprdggeikripvqag
    fvfhhanafeengkiildsicynslpqvdtdgdfrstnfdnldpgqlwrftidpaaatve
    kqlmvsrccefpvvhpqqvgrpyryvymgaahhstgnaplqailkvdlesgtetlrsfap
    hgfagepifvprpggvaeddgwllcliykadlhrselvildaqditapaiatlklkhhip
    yplhgswaqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kjdC (C:)
    qrsyspqdwlrgyqsqpqewdywvedvegsippdlqgtlyrngpglleigdrplkhpfdg
    dgmvtafkfpgdgrvhfqskfvrtqgyveeqkagkmiyrgvfgsqpaggwlktifdlrlk
    niantnitywgdrllalwqggqphrlepsnlatiglddlggilaegqplsahpridpast
    fdggqpcyvtfsiksslsstltlleldpqgkllrqktetfpgfafihdfaitphyaiflq
    nnvtlnglpylfglrgagecvqfhpdkpaqiilvprdggeikripvqagfvfhhanafee
    ngkiildsicynslpqvdtdgdfrstnfdnldpgqlwrftidpaaatvekqlmvsrccef
    pvvhpqqvgrpyryvymgaahhstgnaplqailkvdlesgtetlrsfaphgfagepifvp
    rpggvaeddgwllcliykadlhrselvildaqditapaiatlklkhhipyplhgswaqt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5kjdD (D:)
    mvtspptsspsqrsyspqdwlrgyqsqpqewdywvedvegsippdlqgtlyrngpgllei
    gdrplkhpfdgdgmvtafkfpgdgrvhfqskfvrtqgyveeqkagkmiyrgvfgsqpagg
    wlktifdlrlkniantnitywgdrllalwqggqphrlepsnlatiglddlggilaegqpl
    sahpridpastfdggqpcyvtfsiksslsstltlleldpqgkllrqktetfpgfafihdf
    aitphyaiflqnnvtlnglpylfglrgagecvqfhpdkpaqiilvprdggeikripvqag
    fvfhhanafeengkiildsicynslpqvdtdgdfrstnfdnldpgqlwrftidpaaatve
    kqlmvsrccefpvvhpqqvgrpyryvymgaahhstgnaplqailkvdlesgtetlrsfap
    hgfagepifvprpggvaeddgwllcliykadlhrselvildaqditapaiatlklkhhip
    yplhgswaqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kjdD (D:)
    qrsyspqdwlrgyqsqpqewdywvedvegsippdlqgtlyrngpglleigdrplkhpfdg
    dgmvtafkfpgdgrvhfqskfvrtqgyveeqkagkmiyrgvfgsqpaggwlktifdlrlk
    niantnitywgdrllalwqggqphrlepsnlatiglddlggilaegqplsahpridpast
    fdggqpcyvtfsiksslsstltlleldpqgkllrqktetfpgfafihdfaitphyaiflq
    nnvtlnglpylfglrgagecvqfhpdkpaqiilvprdggeikripvqagfvfhhanafee
    ngkiildsicynslpqvdtdgdfrstnfdnldpgqlwrftidpaaatvekqlmvsrccef
    pvvhpqqvgrpyryvymgaahhstgnaplqailkvdlesgtetlrsfaphgfagepifvp
    rpggvaeddgwllcliykadlhrselvildaqditapaiatlklkhhipyplhgswaqt
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5kjdE (E:)
    mvtspptsspsqrsyspqdwlrgyqsqpqewdywvedvegsippdlqgtlyrngpgllei
    gdrplkhpfdgdgmvtafkfpgdgrvhfqskfvrtqgyveeqkagkmiyrgvfgsqpagg
    wlktifdlrlkniantnitywgdrllalwqggqphrlepsnlatiglddlggilaegqpl
    sahpridpastfdggqpcyvtfsiksslsstltlleldpqgkllrqktetfpgfafihdf
    aitphyaiflqnnvtlnglpylfglrgagecvqfhpdkpaqiilvprdggeikripvqag
    fvfhhanafeengkiildsicynslpqvdtdgdfrstnfdnldpgqlwrftidpaaatve
    kqlmvsrccefpvvhpqqvgrpyryvymgaahhstgnaplqailkvdlesgtetlrsfap
    hgfagepifvprpggvaeddgwllcliykadlhrselvildaqditapaiatlklkhhip
    yplhgswaqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kjdE (E:)
    qrsyspqdwlrgyqsqpqewdywvedvegsippdlqgtlyrngpglleigdrplkhpfdg
    dgmvtafkfpgdgrvhfqskfvrtqgyveeqkagkmiyrgvfgsqpaggwlktifdlrlk
    niantnitywgdrllalwqggqphrlepsnlatiglddlggilaegqplsahpridpast
    fdggqpcyvtfsiksslsstltlleldpqgkllrqktetfpgfafihdfaitphyaiflq
    nnvtlnglpylfglrgagecvqfhpdkpaqiilvprdggeikripvqagfvfhhanafee
    ngkiildsicynslpqvdtdgdfrstnfdnldpgqlwrftidpaaatvekqlmvsrccef
    pvvhpqqvgrpyryvymgaahhstgnaplqailkvdlesgtetlrsfaphgfagepifvp
    rpggvaeddgwllcliykadlhrselvildaqditapaiatlklkhhipyplhgswaqt