PDB entry 5ki2

View 5ki2 on RCSB PDB site
Description: pseudo t4 lysozyme mutant - y18phe-methyl
Class: hydrolase
Keywords: halogen bonds, t4 lysozyme, hydrolase
Deposited on 2016-06-16, released 2017-04-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endolysin
    Species: Enterobacteria phage T4 [TaxId:10665]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00720 (0-End)
      • conflict (11)
      • engineered mutation (17)
      • engineered mutation (53)
      • engineered mutation (96)
      • conflict (136)
    Domains in SCOPe 2.07: d5ki2a_
  • Heterogens: HED, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ki2A (A:)
    mnifemlrideglrlkifkdtegyytigighlltkspslnaakseldkaigrntngvitk
    deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
    lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknlhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ki2A (A:)
    mnifemlrideglrlkifkdtegyytigighlltkspslnaakseldkaigrntngvitk
    deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
    lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk