PDB entry 5khn

View 5khn on RCSB PDB site
Description: crystal structures of the burkholderia multivorans hopanoid transporter hpnn
Deposited on 2016-06-15, released 2017-06-14
The last revision was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 3.45 Å
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RND transporter
    Species: Burkholderia multivorans [TaxId:87883]
    Gene: WM33_10510
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A1B4TSD3 (0-End)
      • engineered mutation (359)
      • engineered mutation (361)
      • engineered mutation (364)
  • Chain 'B':
    Compound: RND transporter
    Species: Burkholderia multivorans [TaxId:87883]
    Gene: WM33_10510
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A1B4TSD3 (0-End)
      • engineered mutation (359)
      • engineered mutation (361)
      • engineered mutation (364)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5khnA (A:)
    mvtslivrlvawsvrrpvwvvvlslliaafsgvyvarhfkintdisklvdaepqwaalsq
    avdrafpqrngtilavveapapefataaahalteslqkqaaagrigpvaepgggpffehn
    gllflspqqvadttsqlasarplvnelaknpsltglattlsttlgqplltgqvklpsmak
    llsrsaatvddvlagkpaafswralvdndaarqparafvtvqpvvnygalkagaqtsdvi
    retaraldlekrygavvrltgeqpladdefssvedgaalngvvtllvvfvilwlalrskr
    miasvlvtlfvglvvtaalglamvgslnmisvafmvlfvglgvdfsiqygvkyreerfrg
    eaidaaligaahsmgmplalattavaasffsfiptayrgvselgliagvgmfvallttlt
    llpallrlfappgesktpgfpwlapvddyldrhrkpiligtlavvigalpllaflhfdfn
    plhlkdphsesmstllalkdspeaavndvtllapsladadaaakrldalpevgrtttlst
    fipadqpekraaiataastllpaltqppappatdaqrvaalkrasdllgyaaedhpgpga
    aaaqhlsqslaklaaadsatrdraerafadtlrialnqlaallqpqeitrdtlppplvrd
    wvapdgkalvqispkvpkgvdpnddtmlrhfatavkaaepgaiggpisilhsantiisaf
    lhaalwsiisitillwitlrrfgdvlrtlvpllvsgivtlemcvvlgmslnfaniialpl
    mlgvgvafkvyfvmawragqtgllhsslthavlfsaattatafgslwlshhpgtssmgkl
    lalaltctligavvfqpvlmgkprvkraknqsqginehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5khnA (A:)
    mvtslivrlvawsvrrpvwvvvlslliaafsgvyvarhfkintdisklvdaepqwaalsq
    avdrafpqrngtilavveapapefataaahalteslqkqaaagrigpvaepgggpffehn
    gllflspqqvadttsqlasarplvnelaknpsltglattlsttlgqplltgqvklpsmak
    llsrsaatvddvlagkpaafswralvdndaarqparafvtvqpvvnaqtsdviretaral
    dlekrygavvrltgeqpladdefssvedgaalngvvtllvvfvilwlalrskrmiasvlv
    tlfvglvvtaalglamvgslnmisvafmvlfvglgvdfsiqygvkyreerfrgeaidaal
    igaahsmgmplalattavaasffsfiptayrgvselgliagvgmfvallttltllpallr
    lfaptpgfpwlapvddyldrhrkpiligtlavvigalpllaflhfdfnplhlkdphsesm
    stllalkdspeaavndvtllapsladadaaakrldalpevgrtttlstfipadqpekraa
    iataastllpaltqppappatdaqrvaalkrasdllgyaaedhpgpgaaaaqhlsqslak
    laaadsatrdraerafadtlrialnqlaallqpqeitrdtlppplvrdwvapdgkalvqi
    spkvpkgvdpnddtmlrhfatavkaaepgaiggpisilhsantiisaflhaalwsiisit
    illwitlrrfgdvlrtlvpllvsgivtlemcvvlgmslnfaniialplmlgvgvafkvyf
    vmawragqtgllhsslthavlfsaattatafgslwlshhpgtssmgkllalaltctliga
    vvfqpvlm
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5khnB (B:)
    mvtslivrlvawsvrrpvwvvvlslliaafsgvyvarhfkintdisklvdaepqwaalsq
    avdrafpqrngtilavveapapefataaahalteslqkqaaagrigpvaepgggpffehn
    gllflspqqvadttsqlasarplvnelaknpsltglattlsttlgqplltgqvklpsmak
    llsrsaatvddvlagkpaafswralvdndaarqparafvtvqpvvnygalkagaqtsdvi
    retaraldlekrygavvrltgeqpladdefssvedgaalngvvtllvvfvilwlalrskr
    miasvlvtlfvglvvtaalglamvgslnmisvafmvlfvglgvdfsiqygvkyreerfrg
    eaidaaligaahsmgmplalattavaasffsfiptayrgvselgliagvgmfvallttlt
    llpallrlfappgesktpgfpwlapvddyldrhrkpiligtlavvigalpllaflhfdfn
    plhlkdphsesmstllalkdspeaavndvtllapsladadaaakrldalpevgrtttlst
    fipadqpekraaiataastllpaltqppappatdaqrvaalkrasdllgyaaedhpgpga
    aaaqhlsqslaklaaadsatrdraerafadtlrialnqlaallqpqeitrdtlppplvrd
    wvapdgkalvqispkvpkgvdpnddtmlrhfatavkaaepgaiggpisilhsantiisaf
    lhaalwsiisitillwitlrrfgdvlrtlvpllvsgivtlemcvvlgmslnfaniialpl
    mlgvgvafkvyfvmawragqtgllhsslthavlfsaattatafgslwlshhpgtssmgkl
    lalaltctligavvfqpvlmgkprvkraknqsqginehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5khnB (B:)
    mvtslivrlvawsvrrpvwvvvlslliaafsgvyvarhfkintdisklvdaepqwaalsq
    avdrafpqrngtilavveapapefataaahalteslqkqaaagrigpvaepgggpffehn
    gllflspqqvadttsqlasarplvnelaknpsltglattlsttlgqplltgqvklpsmak
    llsrsaatvddvlagkpaafswralvdndaarqparafvtvqpvvngaqtsdviretara
    ldlekrygavvrltgeqpladdefssvedgaalngvvtllvvfvilwlalrskrmiasvl
    vtlfvglvvtaalglamvgslnmisvafmvlfvglgvdfsiqygvkyreerfrgeaidaa
    ligaahsmgmplalattavaasffsfiptayrgvselgliagvgmfvallttltllpall
    rlfappgfpwlapvddyldrhrkpiligtlavvigalpllaflhfdfnplhlkdphsesm
    stllalkdspeaavndvtllapsladadaaakrldalpevgrtttlstfipadqpekraa
    iataastllpaltqppappatdaqrvaalkrasdllgyaaedhpgpgaaaaqhlsqslak
    laaadsatrdraerafadtlrialnqlaallqpqeitrdtlppplvrdwvapdgkalvqi
    spkvpkgvdpnddtmlrhfatavkaaepgaiggpisilhsantiisaflhaalwsiisit
    illwitlrrfgdvlrtlvpllvsgivtlemcvvlgmslnfaniialplmlgvgvafkvyf
    vmawragqtgllhsslthavlfsaattatafgslwlshhpgtssmgkllalaltctliga
    vvfqpvlm