PDB entry 5khh

View 5khh on RCSB PDB site
Description: HCN2 CNBD in complex with inosine-3', 5'-cyclic monophosphate (cIMP)
Class: transport protein
Keywords: protein-ligand complex, cycilc nucleotide binding domain, ion transport, TRANSPORT PROTEIN
Deposited on 2016-06-14, released 2016-09-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-09-14, with a file datestamp of 2016-09-09.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2
    Species: Mus musculus [TaxId:10090]
    Gene: Hcn2, Bcng2, Hac1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5khha_
  • Heterogens: 6SW, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5khhA (A:)
    snadssrrqyqekykqveqymsfhklpadfrqkihdyyehryqgkmfdedsilgelngpl
    reeivnfncrklvasmplfanadpnfvtamltklkfevfqpgdyiiregtigkkmyfiqh
    gvvsvltkgnkemklsdgsyfgeiclltrgrrtasvradtycrlyslsvdnfnevleeyp
    mmrrafetvaidrldrigkknsil
    

    Sequence, based on observed residues (ATOM records): (download)
    >5khhA (A:)
    ssrrqyqekykqveqymsfhklpadfrqkihdyyehryqgkmfdedsilgelngplreei
    vnfncrklvasmplfanadpnfvtamltklkfevfqpgdyiiregtigkkmyfiqhgvvs
    vltkgnkemklsdgsyfgeiclltrgrrtasvradtycrlyslsvdnfnevleeypmmrr
    afetvaidrldrigk