PDB entry 5kh3

View 5kh3 on RCSB PDB site
Description: crystal structure of fragment (3-(5-chloro-1,3-benzothiazol-2-yl) propanoic acid) bound in the ubiquitin binding pocket of the hdac6 zinc-finger domain
Deposited on 2016-06-14, released 2016-07-27
The last revision was dated 2019-02-27, with a file datestamp of 2019-02-22.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone deacetylase 6
    Species: Homo sapiens [TaxId:9606]
    Gene: HDAC6, KIAA0901, JM21
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UBN7 (2-End)
      • expression tag (1)
  • Heterogens: ZN, UNX, 6U6, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5kh3A (A:)
    gsplpwcphlvavcpipaagldvtqpcgdcgtiqenwvclscyqvycgryinghmlqhhg
    nsghplvlsyidlsawcyycqayvhhqalldvkniahqnkfgedmph
    

    Sequence, based on observed residues (ATOM records):
    >5kh3A (A:)
    splpwcphlvavcpipaagldvtqpcgdcgtiqenwvclscyqvycgryinghmlqhhgn
    sghplvlsyidlsawcyycqayvhhqalldvkniahqnkfg