PDB entry 5kgq

View 5kgq on RCSB PDB site
Description: nmr structure and dynamics of q4dy78, a conserved kinetoplasid- specific protein from trypanosoma cruzi
Deposited on 2016-06-13, released 2017-07-05
The last revision was dated 2020-01-08, with a file datestamp of 2020-01-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein
    Species: TRYPANOSOMA CRUZI [TaxId:5693]
    Gene: Tc00.1047053511907.89
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4DY78 (6-111)
      • expression tag (0-5)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >5kgqA (A:)
    gsamghmvkishedtqriktaflsyaqgqdkvteamidqlicgafpglsweqlqekkkgr
    aaangydrsaffslvasdeqyvrfiaqhfpcapeeekppeidalelktqkgf