PDB entry 5kgm

View 5kgm on RCSB PDB site
Description: 2.95a resolution structure of apo independent phosphoglycerate mutase from c. elegans (monoclinic form)
Deposited on 2016-06-13, released 2017-04-05
The last revision was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: ipgm-1, F57B10.3
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: ipgm-1, F57B10.3
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CL, MN, ZN

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5kgmA (A:)
    mfvalgaqiyrqyfgrrgmamannssvankvclividgwgvsedpygnailnaqtpvmdk
    lcsgnwaqieahglhvglpeglmgnsevghlnigagrviyqdivrinlavknnkfvtnes
    lvdacdrakngngrlhlaglvsdggvhshidhmfalvkaikelgvpelylhfygdgrdts
    pnsgvgfleqtleflekttgygklatvvgryyamdrdnrwerinvayeamiggvgetsde
    agvvevvrkryaadetdeflkpiilqgekgrvqnddtiiffdyradrmreisaamgmdry
    kdcnsklahpsnlqvygmtqykaefpfkslfppasnknvlaewlaeqkvsqfhcaeteky
    ahvtfffngglekqfegeerclvpspkvatydlqpemsaagvadkmieqleagthpfimc
    nfappdmvghtgvyeaavkaceatdiaigriyeatqkhgyslmvtadhgnaekmkapdgg
    khtahtcyrvpltlshpgfkfvdpadrhpalcdvaptvlaimglpqpaemtgvsivqkik
    laaalehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5kgmA (A:)
    amannssvankvclividgwgvsedpygnailnaqtpvmdklcsgnwaqieahglhvglp
    eglmgnsevghlnigagrviyqdivrinlavknnkfvtneslvdacdrakngngrlhlag
    lvsdggvhshidhmfalvkaikelgvpelylhfygdgrdtspnsgvgfleqtleflettg
    ygklatvvgryyamdrdnrwerinvayeamiggvgetsdeagvvevvrkryaadetdefl
    kpiilqgekgrvqnddtiiffdyradrmreisaamgmdrykdcnsklahpsnlqvygmtq
    ykaefpfkslfppasnknvlaewlaeqkvsqfhcaetekyahvtfffngglekqfegeer
    clvpspkvatydlqpemsaagvadkmieqleagthpfimcnfappdmvghtgvyeaavka
    ceatdiaigriyeatqkhgyslmvtadhgnaekmkapdggkhtahtcyrvpltlshpgfk
    fvdpadrhpalcdvaptvlaimglpqpaemtgvsivqki
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5kgmB (B:)
    mfvalgaqiyrqyfgrrgmamannssvankvclividgwgvsedpygnailnaqtpvmdk
    lcsgnwaqieahglhvglpeglmgnsevghlnigagrviyqdivrinlavknnkfvtnes
    lvdacdrakngngrlhlaglvsdggvhshidhmfalvkaikelgvpelylhfygdgrdts
    pnsgvgfleqtleflekttgygklatvvgryyamdrdnrwerinvayeamiggvgetsde
    agvvevvrkryaadetdeflkpiilqgekgrvqnddtiiffdyradrmreisaamgmdry
    kdcnsklahpsnlqvygmtqykaefpfkslfppasnknvlaewlaeqkvsqfhcaeteky
    ahvtfffngglekqfegeerclvpspkvatydlqpemsaagvadkmieqleagthpfimc
    nfappdmvghtgvyeaavkaceatdiaigriyeatqkhgyslmvtadhgnaekmkapdgg
    khtahtcyrvpltlshpgfkfvdpadrhpalcdvaptvlaimglpqpaemtgvsivqkik
    laaalehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5kgmB (B:)
    amannssvankvclividgwgvsedpygnailnaqtpvmdklcsgnwaqieahglhvglp
    eglmgnsevghlnigagrviyqdivrinlavknnkfvtneslvdacdrakngngrlhlag
    lvsdggvhshidhmfalvkaikelgvpelylhfygdgrdtspnsgvgfleqtlefletgy
    gklatvvgryyamdrdnrwerinvayeamiggvgetsdeagvvevvrkryaadetdeflk
    piilqgekgrvqnddtiiffdyradrmreisaamgmdrykdcnsklahpsnlqvygmtqy
    kaefpfkslfppasnknvlaewlaeqkvsqfhcaetekyahvtfffngglekqfegeerc
    lvpspkvatydlqpemsaagvadkmieqleagthpfimcnfappdmvghtgvyeaavkac
    eatdiaigriyeatqkhgyslmvtadhgnaekmkapdggkhtahtcyrvpltlshpgfkf
    vdpadrhpalcdvaptvlaimglpqpaemtgvsivqki