PDB entry 5kg9

View 5kg9 on RCSB PDB site
Description: Crystal structure of the gp120 v2 antibody RE505-22 Fab from IGH- and IGK-humanized mouse
Class: immune system
Keywords: HIV-1 gp120 antibody Fab, IMMUNE SYSTEM
Deposited on 2016-06-13, released 2017-01-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Antibody RE505-22 Fab heavy chain
    Species: MUS MUSCULUS, HOMO SAPIENS [TaxId:10090, 9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5KG9
  • Chain 'B':
    Compound: Antibody RE505-22 Fab light chain
    Species: MUS MUSCULUS, HOMO SAPIENS [TaxId:10090, 9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5KG9 (0-End)
    Domains in SCOPe 2.07: d5kg9b1, d5kg9b2
  • Chain 'H':
    Compound: Antibody RE505-22 Fab heavy chain
    Species: MUS MUSCULUS, HOMO SAPIENS [TaxId:10090, 9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5KG9
  • Chain 'L':
    Compound: Antibody RE505-22 Fab light chain
    Species: MUS MUSCULUS, HOMO SAPIENS [TaxId:10090, 9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5KG9 (0-End)
    Domains in SCOPe 2.07: d5kg9l1, d5kg9l2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5kg9B (B:)
    qlvltqsssasfslgasakltctlssqhstytiewyqqqplkppkfvmelrkdgshntgd
    gipdrfsgsssgadrylsisniqpedeaiyicgvgdtikeqfvyvfgggtkvtvlgqpka
    apsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnk
    yaassylsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kg9B (B:)
    qlvltqsssasfslgasakltctlssqhstytiewyqqqplkppkfvmelrkdgshntgd
    gipdrfsgsssgadrylsisniqpedeaiyicgvgdtikeqfvyvfgggtkvtvlgqpka
    apsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnk
    yaassylsltpeqwkshrsyscqvthegstvektvapt
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5kg9L (L:)
    qlvltqsssasfslgasakltctlssqhstytiewyqqqplkppkfvmelrkdgshntgd
    gipdrfsgsssgadrylsisniqpedeaiyicgvgdtikeqfvyvfgggtkvtvlgqpka
    apsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnk
    yaassylsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kg9L (L:)
    qlvltqsssasfslgasakltctlssqhstytiewyqqqplkppkfvmelrkdgshntgd
    gipdrfsgsssgadrylsisniqpedeaiyicgvgdtikeqfvyvfgggtkvtvlgqpka
    apsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnk
    yaassylsltpeqwkshrsyscqvthegstvektvapt