PDB entry 5kg8

View 5kg8 on RCSB PDB site
Description: rigor myosin x co-complexed with an actin filament
Deposited on 2016-06-12, released 2016-09-07
The last revision was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: EM
Resolution: 9.1 Å
R-factor: N/A
AEROSPACI score: -0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Unconventional myosin-X
    Species: Homo sapiens [TaxId:9606]
    Gene: MYO10, KIAA0799
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Actin, alpha skeletal muscle
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68135
      • conflict (72)
  • Chain 'C':
    Compound: Actin, alpha skeletal muscle
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68135
      • conflict (72)
  • Chain 'D':
    Compound: Actin, alpha skeletal muscle
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68135
      • conflict (72)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5kg8A (A:)
    nfftegtrvwlrengqhfpstvnscaegivvfrtdygqvftykqstithqkvtamhptne
    egvddmasltelhggsimynlfqrykrnqiytyigsilasvnpyqpiaglyepatmeqys
    rrhlgelpphifaianecyrclwkrhdnqcilisgesgagktestklilkflsvisqqsl
    elslkektscverailesspimeafgnaktvynnnssrfgkfvqlnicqkgniqggrivd
    ylleknrvvrqnpgernyhifyallagleheereefylstpenyhylnqsgcvedktisd
    qesfrevitamdvmqfskeevrevsrllagilhlgniefitaggaqvsfktalgrsaell
    gldptqltdaltqrsmflrgeeiltplnvqqavdsrdslamalyaccfewvikkinsrik
    gnedfksigildifgfenfevnhfeqfninyaneklqeyfnkhifsleqleysreglvwe
    didwidngecldliekklgllalineeshfpqatdstlleklhsqhannhfyvkprvavn
    nfgvkhyagevqydvrgileknrdtfrddllnllresrfdfiydlfehvssrnnqdaaaa
    aaaarrptvssqfkdslhslmatlsssnpffvrcikpnmqkmpdqfdqavvlnqlrysgm
    letvrirkagyavrrpfqdfykrykvlmrnlalpedvrgkctsllqlydasnsewqlgkt
    kvflresleqklekrreee
    

    Sequence, based on observed residues (ATOM records):
    >5kg8A (A:)
    nfftegtrvwlrengqhfpstvnscaegivvfrtdygqvftykqstithqkvtamhptne
    eddmasltelhggsimynlfqrykrnqiytyigsilasvnpyqmeqysrrhlgelpphif
    aianecyrclwkrhdnqcilisgesgagktestklilkflsvislesspimeafgnaktv
    ynnnssrfgkfvqlnicqkgniqggrivdylleknrvvrqnpgernyhifyallaglehe
    ereefylstpenyhylnqsgcvedktisdqesfrevitamdvmqfskeevrevsrllagi
    lhlgniefitaggaqvsfktalgrsaellgldptqltdaltqrsmflrgeeiltplnvqq
    avdsrdslamalyaccfewvikkinsriigildifgfenfevnhfeqfninyaneklqey
    fnkhifsleqleysreglvwedidwidngecldliekklgllalineeshfpqatdstll
    eklhsqhannhfyvkprvavnnfgvkhyagevqydvrgileknrdtfrddllnllresrf
    dfiydlfrrptvssqfkdslhslmatlsssnpffvrcikpnmqkmpdqfdqavvlnqlry
    sgmletvrirkaavrrpfqdfykrykvlmrnlalpedvrgkctsllqlydasnsewqlgk
    tkvflresleqklekrr
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5kg8B (B:)
    dedettalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqs
    krgiltlkypiecgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmt
    qimfetfnvpamyvaiqavlslyasgrttgivldsgdgvthnvpiyegyalphaimrldl
    agrdltdylmkiltergysfvttaereivrdikeklcyvaldfenemataassssleksy
    elpdgqvitignerfrcpetlfqpsfigmesagihettynsimkcdidirkdlyannvms
    ggttmypgiadrmqkeitalapstmkikiiapperkysvwiggsilaslstfqqmwitkq
    eydeagpsivhrkcf
    

    Sequence, based on observed residues (ATOM records):
    >5kg8B (B:)
    ttalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgi
    ltlkypiecgiitnwddmekiwhhtfynelrvapeehptlltekmtqimfetfnvpamyv
    aiqavlslyasgrttgivldsgdgvthnvpiyegyalphaimrlysfvttaereivrdik
    eklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqpsfigmesag
    ihettynypgiadrmqkeitalapstmkikiiapperkysvwiggsilaslstfqqmwit
    kqeydeagpsivh
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5kg8C (C:)
    dedettalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqs
    krgiltlkypiecgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmt
    qimfetfnvpamyvaiqavlslyasgrttgivldsgdgvthnvpiyegyalphaimrldl
    agrdltdylmkiltergysfvttaereivrdikeklcyvaldfenemataassssleksy
    elpdgqvitignerfrcpetlfqpsfigmesagihettynsimkcdidirkdlyannvms
    ggttmypgiadrmqkeitalapstmkikiiapperkysvwiggsilaslstfqqmwitkq
    eydeagpsivhrkcf
    

    Sequence, based on observed residues (ATOM records):
    >5kg8C (C:)
    ttalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgi
    ltlkypiecgiitnwddmekiwhhtfynelrvapeehptlltekmtqimfetfnvpamyv
    aiqavlslyasgrttgivldsgdgvthnvpiyegyalphaimrlysfvttaereivrdik
    eklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqpsfigmesag
    ihettynypgiadrmqkeitalapstmkikiiapperkysvwiggsilaslstfqqmwit
    kqeydeagpsivh
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5kg8D (D:)
    dedettalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqs
    krgiltlkypiecgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmt
    qimfetfnvpamyvaiqavlslyasgrttgivldsgdgvthnvpiyegyalphaimrldl
    agrdltdylmkiltergysfvttaereivrdikeklcyvaldfenemataassssleksy
    elpdgqvitignerfrcpetlfqpsfigmesagihettynsimkcdidirkdlyannvms
    ggttmypgiadrmqkeitalapstmkikiiapperkysvwiggsilaslstfqqmwitkq
    eydeagpsivhrkcf
    

    Sequence, based on observed residues (ATOM records):
    >5kg8D (D:)
    ttalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgi
    ltlkypiecgiitnwddmekiwhhtfynelrvapeehptlltekmtqimfetfnvpamyv
    aiqavlslyasgrttgivldsgdgvthnvpiyegyalphaimrlysfvttaereivrdik
    eklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqpsfigmesag
    ihettynypgiadrmqkeitalapstmkikiiapperkysvwiggsilaslstfqqmwit
    kqeydeagpsivh