PDB entry 5kg6

View 5kg6 on RCSB PDB site
Description: human dna polymerase eta-dna ternary complex: reaction first with 1 mm mn2+ for 1800s then with 10 mm ca2+ for 60s
Deposited on 2016-06-12, released 2016-06-29
The last revision was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA Polymerase ETA
    Species: Homo sapiens [TaxId:9606]
    Gene: POLH, RAD30, RAD30A, XPV
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y253 (3-434)
      • expression tag (0-2)
  • Chain 'P':
    Compound: DNA (5'-d(*ap*gp*cp*gp*tp*cp*ap*tp*a)-3')
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
  • Chain 'T':
    Compound: DNA (5'-d(*cp*ap*tp*tp*ap*tp*gp*ap*cp*gp*cp*t)-3')
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
  • Heterogens: MN, GOL, DTP, DPO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5kg6A (A:)
    gphmatgqdrvvalvdmdcffvqveqrqnphlrnkpcavvqykswkgggiiavsyearaf
    gvtrsmwaddakklcpdlllaqvresrgkanltkyreasvevmeimsrfavierasidea
    yvdltsavqerlqklqgqpisadllpstyieglpqgpttaeetvqkegmrkqglfqwlds
    lqidnltspdlqltvgaviveemraaieretgfqcsagishnkvlaklacglnkpnrqtl
    vshgsvpqlfsqmpirkirslggklgasvieilgieymgeltqftesqlqshfgekngsw
    lyamcrgiehdpvkprqlpktigcsknfpgktalatreqvqwwllqlaqeleerltkdrn
    dndrvatqlvvsirvqgdkrlsslrrccaltrydahkmshdaftvikncntsgiqtewsp
    pltmlflcatkfsas
    

    Sequence, based on observed residues (ATOM records):
    >5kg6A (A:)
    gphmatgqdrvvalvdmdcffvqveqrqnphlrnkpcavvqykswkgggiiavsyearaf
    gvtrsmwaddakklcpdlllaqvresrgkanltkyreasvevmeimsrfavierasidea
    yvdltsavqerlqklqgqpisadllpstyieglpqgpetvqkegmrkqglfqwldslqid
    nltspdlqltvgaviveemraaieretgfqcsagishnkvlaklacglnkpnrqtlvshg
    svpqlfsqmpirkirslggklgasvieilgieymgeltqftesqlqshfgekngswlyam
    crgiehdpvkprqlpktigcsknfpgktalatreqvqwwllqlaqeleerltkdrndndr
    vatqlvvsirvqgdkrlsslrrccaltrydahkmshdaftvikncntsgiqtewsppltm
    lflcatkfsas
    

  • Chain 'P':
    No sequence available.

  • Chain 'T':
    No sequence available.