PDB entry 5kfs

View 5kfs on RCSB PDB site
Description: human dna polymerase eta r61a-dna ternary complex: ground state at ph7.0 (k+ mes) with 1 ca2+ ion
Deposited on 2016-06-12, released 2016-06-29
The last revision was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 1.46 Å
R-factor: N/A
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA Polymerase ETA
    Species: Homo sapiens [TaxId:9606]
    Gene: POLH, RAD30, RAD30A, XPV
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y253 (3-434)
      • expression tag (0-2)
      • engineered mutation (63)
  • Chain 'P':
    Compound: DNA (5'-d(*ap*gp*cp*gp*tp*cp*ap*t)-3')
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
  • Chain 'T':
    Compound: DNA (5'-d(*cp*ap*tp*tp*ap*tp*gp*ap*cp*gp*cp*t)-3')
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
  • Heterogens: CA, GOL, DTP, K, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5kfsA (A:)
    gphmatgqdrvvalvdmdcffvqveqrqnphlrnkpcavvqykswkgggiiavsyearaf
    gvtasmwaddakklcpdlllaqvresrgkanltkyreasvevmeimsrfavierasidea
    yvdltsavqerlqklqgqpisadllpstyieglpqgpttaeetvqkegmrkqglfqwlds
    lqidnltspdlqltvgaviveemraaieretgfqcsagishnkvlaklacglnkpnrqtl
    vshgsvpqlfsqmpirkirslggklgasvieilgieymgeltqftesqlqshfgekngsw
    lyamcrgiehdpvkprqlpktigcsknfpgktalatreqvqwwllqlaqeleerltkdrn
    dndrvatqlvvsirvqgdkrlsslrrccaltrydahkmshdaftvikncntsgiqtewsp
    pltmlflcatkfsas
    

    Sequence, based on observed residues (ATOM records):
    >5kfsA (A:)
    gphmatgqdrvvalvdmdcffvqveqrqnphlrnkpcavvqykswkgggiiavsyearaf
    gvtasmwaddakklcpdlllaqvresrgkanltkyreasvevmeimsrfavierasidea
    yvdltsavqerlqklqgqpisadllpstyieglpqgptvqkegmrkqglfqwldslqidn
    ltspdlqltvgaviveemraaieretgfqcsagishnkvlaklacglnkpnrqtlvshgs
    vpqlfsqmpirkirslggklgasvieilgieymgeltqftesqlqshfgekngswlyamc
    rgiehdpvkprqlpktigcsknfpgktalatreqvqwwllqlaqeleerltkdrndndrv
    atqlvvsirvqgdkrlsslrrccaltrydahkmshdaftvikncntsgiqtewsppltml
    flcatkfsas
    

  • Chain 'P':
    No sequence available.

  • Chain 'T':
    No sequence available.