PDB entry 5kf8

View 5kf8 on RCSB PDB site
Description: x-ray structure of a glucosamine n-acetyltransferase from clostridium acetobutylicum in complex with glucosamine
Deposited on 2016-06-12, released 2016-07-06
The last revision was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Predicted acetyltransferase
    Species: Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) [TaxId:272562]
    Gene: CA_C0184
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ACO, EDO, GCS, EP1, COA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5kf8A (A:)
    meiketydfssivdlwnknigtvypmnlelfkqnyindrqrkkimgafngeiligfviyk
    qwtyksgslkpnhkigyinsiivdinfrhqgigtklldaaeeelinsgvkilrcgsdtyh
    ffpgipleclpseefflvrgykmqdyfydligdvskvdfkkpsikdgfkvnvmkpedrkg
    lfefleksfsgrwleefieffqvgmkerdivlikyktsvigfshiydnkssfigppiywk
    allghnygglgpigidktyrkqglgrlllyeslqilkkrevkkmvidwtekdiinfygrf
    nfmpwkayrkatkevkdgkggghhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5kf8A (A:)
    meiketydfssivdlwnknigtvypmnlelfkqnyindrqrkkimgafngeiligfviyk
    qwtyksgslkpnhkigyinsiivdinfrhqgigtklldaaeeelinsgvkilrcgsdtyh
    ffpgipleclpseefflvrgykmqdyfydligdvskvdfkkpsikdgfkvnvmkpedrkg
    lfefleksfsgrwleefieffqvgmkerdivlikyktsvigfshiydnkssfigppiywk
    allghnygglgpigidktyrkqglgrlllyeslqilkkrevkkmvidwtekdiinfygrf
    nfmpwkayrkatkevkd