PDB entry 5kf4

View 5kf4 on RCSB PDB site
Description: crystal structure of fn3 domain (residues p368-p466) of human collagen xx
Deposited on 2016-06-12, released 2016-07-06
The last revision was dated 2017-12-27, with a file datestamp of 2017-12-22.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Collagen alpha-1(XX) chain
    Species: Homo sapiens [TaxId:9606]
    Gene: COL20A1, KIAA1510
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Collagen alpha-1(XX) chain
    Species: Homo sapiens [TaxId:9606]
    Gene: COL20A1, KIAA1510
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Collagen alpha-1(XX) chain
    Species: Homo sapiens [TaxId:9606]
    Gene: COL20A1, KIAA1510
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Collagen alpha-1(XX) chain
    Species: Homo sapiens [TaxId:9606]
    Gene: COL20A1, KIAA1510
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5kf4A (A:)
    gpaaapaldtlpaptslvlsqvtsssirlswtpaprhplkylivwrasrggtprevvveg
    paastelhnlasrteylvsvfpiyeggvgeglrglvttap
    

    Sequence, based on observed residues (ATOM records):
    >5kf4A (A:)
    paaapaldtlpaptslvlsqvtsssirlswtpaprhplkylivwrasrggtprevvvegp
    aastelhnlasrteylvsvfpiyeggvgeglrglvttap
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5kf4B (B:)
    gpaaapaldtlpaptslvlsqvtsssirlswtpaprhplkylivwrasrggtprevvveg
    paastelhnlasrteylvsvfpiyeggvgeglrglvttap
    

    Sequence, based on observed residues (ATOM records):
    >5kf4B (B:)
    paaapaldtlpaptslvlsqvtsssirlswtpaprhplkylivwrasrggtprevvvegp
    aastelhnlasrteylvsvfpiyeggvgeglrglvttap
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5kf4C (C:)
    gpaaapaldtlpaptslvlsqvtsssirlswtpaprhplkylivwrasrggtprevvveg
    paastelhnlasrteylvsvfpiyeggvgeglrglvttap
    

    Sequence, based on observed residues (ATOM records):
    >5kf4C (C:)
    aaapaldtlpaptslvlsqvtsssirlswtpaprhplkylivwrasrggtprevvvegpa
    astelhnlasrteylvsvfpiyeggvgeglrglvtt
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5kf4D (D:)
    gpaaapaldtlpaptslvlsqvtsssirlswtpaprhplkylivwrasrggtprevvveg
    paastelhnlasrteylvsvfpiyeggvgeglrglvttap
    

    Sequence, based on observed residues (ATOM records):
    >5kf4D (D:)
    aaapaldtlpaptslvlsqvtsssirlswtpaprhplkylivwrasrggtprevvvegpa
    astelhnlasrteylvsvfpiyeggvgeglrglvtta