PDB entry 5ker

View 5ker on RCSB PDB site
Description: Deer mouse recombinant hemoglobin from high altitude species
Class: transport protein
Keywords: oxygen-transport, TRANSPORT PROTEIN
Deposited on 2016-06-10, released 2017-04-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-04-19, with a file datestamp of 2017-04-14.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-globin
    Species: Peromyscus maniculatus [TaxId:10042]
    Gene: HBA, Hba, HBAT1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5kera_
  • Chain 'B':
    Compound: Beta globin
    Species: Peromyscus maniculatus [TaxId:10042]
    Gene: HBB, HBB-T1, HBB-T2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5kerb_
  • Chain 'C':
    Compound: Alpha-globin
    Species: Peromyscus maniculatus [TaxId:10042]
    Gene: HBA, Hba, HBAT1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5kerc_
  • Chain 'D':
    Compound: Beta globin
    Species: Peromyscus maniculatus [TaxId:10042]
    Gene: HBB, HBB-T1, HBB-T2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5kerd_
  • Chain 'E':
    Compound: Alpha-globin
    Species: Peromyscus maniculatus [TaxId:10042]
    Gene: HBA, Hba, HBAT1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5kere_
  • Chain 'F':
    Compound: Beta globin
    Species: Peromyscus maniculatus [TaxId:10042]
    Gene: HBB, HBB-T1, HBB-T2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5kerf_
  • Chain 'G':
    Compound: Alpha-globin
    Species: Peromyscus maniculatus [TaxId:10042]
    Gene: HBA, Hba, HBAT1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5kerg_
  • Chain 'H':
    Compound: Beta globin
    Species: Peromyscus maniculatus [TaxId:10042]
    Gene: HBB, HBB-T1, HBB-T2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5kerh_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5kerA (A:)
    vlsaddkanikaawgkigghgaeygaealermfcsfpttktyfphfdvspgsaqvkghga
    kvagalataashlddlpaalsalsdlhahklrvdpvnfkllshcllvtlaahhpaeftpa
    vhasldkflasvstvltskyr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kerA (A:)
    vlsaddkanikaawgkigghgaeygaealermfcsfpttktyfphfdvspgsaqvkghga
    kvagalataashlddlpaalsalsdlhahklrvdpvnfkllshcllvtlaahhpaeftpa
    vhasldkflasvstvltsky
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5kerB (B:)
    vhltdaekalvtglwgkvkpeeiggealgrllavypwtqrffdsfgdlssasaimgnakv
    kghgkkvidsfgeglkhldnlkgtfaslselhcdklhvdpenfkllgnmivivmahhlgk
    dftpaaqaayqkvvagvatalahkyh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5kerC (C:)
    vlsaddkanikaawgkigghgaeygaealermfcsfpttktyfphfdvspgsaqvkghga
    kvagalataashlddlpaalsalsdlhahklrvdpvnfkllshcllvtlaahhpaeftpa
    vhasldkflasvstvltskyr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kerC (C:)
    vlsaddkanikaawgkigghgaeygaealermfcsfpttktyfphfdvspgsaqvkghga
    kvagalataashlddlpaalsalsdlhahklrvdpvnfkllshcllvtlaahhpaeftpa
    vhasldkflasvstvltsky
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5kerD (D:)
    vhltdaekalvtglwgkvkpeeiggealgrllavypwtqrffdsfgdlssasaimgnakv
    kghgkkvidsfgeglkhldnlkgtfaslselhcdklhvdpenfkllgnmivivmahhlgk
    dftpaaqaayqkvvagvatalahkyh
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5kerE (E:)
    vlsaddkanikaawgkigghgaeygaealermfcsfpttktyfphfdvspgsaqvkghga
    kvagalataashlddlpaalsalsdlhahklrvdpvnfkllshcllvtlaahhpaeftpa
    vhasldkflasvstvltskyr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kerE (E:)
    vlsaddkanikaawgkigghgaeygaealermfcsfpttktyfphfdvspgsaqvkghga
    kvagalataashlddlpaalsalsdlhahklrvdpvnfkllshcllvtlaahhpaeftpa
    vhasldkflasvstvltsky
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5kerF (F:)
    vhltdaekalvtglwgkvkpeeiggealgrllavypwtqrffdsfgdlssasaimgnakv
    kghgkkvidsfgeglkhldnlkgtfaslselhcdklhvdpenfkllgnmivivmahhlgk
    dftpaaqaayqkvvagvatalahkyh
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5kerG (G:)
    vlsaddkanikaawgkigghgaeygaealermfcsfpttktyfphfdvspgsaqvkghga
    kvagalataashlddlpaalsalsdlhahklrvdpvnfkllshcllvtlaahhpaeftpa
    vhasldkflasvstvltskyr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kerG (G:)
    vlsaddkanikaawgkigghgaeygaealermfcsfpttktyfphfdvspgsaqvkghga
    kvagalataashlddlpaalsalsdlhahklrvdpvnfkllshcllvtlaahhpaeftpa
    vhasldkflasvstvltsky
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5kerH (H:)
    vhltdaekalvtglwgkvkpeeiggealgrllavypwtqrffdsfgdlssasaimgnakv
    kghgkkvidsfgeglkhldnlkgtfaslselhcdklhvdpenfkllgnmivivmahhlgk
    dftpaaqaayqkvvagvatalahkyh