PDB entry 5keb

View 5keb on RCSB PDB site
Description: mouse klf4 znf1-3 (e446d) and cpg/cpg sequence dna complex structure: form ii
Deposited on 2016-06-09, released 2016-09-14
The last revision was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: krueppel-like factor 4
    Species: Mus musculus [TaxId:10090]
    Gene: Klf4, Ezf, Gklf, Zie
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q60793 (Start-92)
      • engineered mutation (55)
  • Chain 'B':
    Compound: DNA (5'-d(*gp*ap*gp*gp*cp*gp*tp*gp*gp*c)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'C':
    Compound: DNA (5'-d(*gp*cp*cp*ap*cp*gp*cp*cp*tp*c)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Heterogens: ZN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5kebA (A:)
    gplgsrtathtcdyagcgktytksshlkahlrthtgekpyhcdwdgcgwkfarsddltrh
    yrkhtghrpfqcqkcdrafsrsdhlalhmkrhf
    

    Sequence, based on observed residues (ATOM records):
    >5kebA (A:)
    htcdyagcgktytksshlkahlrthtgekpyhcdwdgcgwkfarsddltrhyrkhtghrp
    fqcqkcdrafsrsdhlalhmkrhf
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.