PDB entry 5kdz

View 5kdz on RCSB PDB site
Description: The crystal structure of the T252A mutant of CYP199A4 in complex with 4-methoxybenzoate
Class: oxidoreductase
Keywords: P450, Oxidoreductase
Deposited on 2016-06-08, released 2018-02-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-02-07, with a file datestamp of 2018-02-02.
Experiment type: XRAY
Resolution: 1.42 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450
    Species: Rhodopseudomonas palustris (strain HaA2) [TaxId:316058]
    Gene: RPB_3613
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2IU02 (0-392)
      • engineered mutation (235)
    Domains in SCOPe 2.07: d5kdza_
  • Heterogens: ANN, HEM, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5kdzA (A:)
    tiphlaidpfsldffddpypdqqtlrdagpvvyldkwnvygvaryaevhavlndpttfcs
    srgvglsdfkkekpwrppslileadppahtrpravlskvlspatmktirdgfaaaadakv
    dellqrgcidaiadlaeayplsvfpdamglkqegrehllpyaglvfnafgppnelrqtai
    ersaphqayvneqcqrpnlapggfgacihaftdtgeitpdeapllvrsllsagldatvng
    igaavyclarfpgelqrlrsdptlarnafeeavrfespvqtffrtttrevelggavigeg
    ekvlmflgsanrdprrwsdpdlyditrktsghvgfgsgvhmcvgqlvarlegevmlsala
    rkvaaididgpvkrrfnntlrgleslpvkltpa