PDB entry 5kdw

View 5kdw on RCSB PDB site
Description: impa metallopeptidase from pseudomonas aeruginosa
Deposited on 2016-06-08, released 2017-01-11
The last revision was dated 2017-02-08, with a file datestamp of 2017-02-03.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Metallopeptidase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964]
    Gene: PA0572
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I5W4 (1-882)
      • expression tag (883)
  • Chain 'B':
    Compound: Metallopeptidase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964]
    Gene: PA0572
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I5W4 (1-882)
      • expression tag (883)
  • Heterogens: EDO, ZN, PO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5kdwA (A:)
    matqeeildaalvsgdssqltdshlvalrlqqqverirqtrtqlldglyqnlsqaydpga
    asmwvlpanpdntlpfligdkgrvlaslsleaggrglaygtnvltqlsgtnaahapllkr
    avqwlvngdpgaatakdfkvsvvgvdktaalnglksaglqpadaacnaltdascastskl
    lvlgngasaaslsatvrarlqaglpilfvhtngwnqsstgqqilaglglqegpyggnywd
    kdrvpssrtrtrsvelggaygqdpalvqqivdgswrtdydwskctsyvgrttcddvpgls
    dfskrvdvlkgaldaynqkaqnlfalpgttslrlwllwadavrqnirypmdkaadtarfq
    etfvadaivgyvreagaaqkelgsyagqrqqsmpvsgseetltltlpsaqgftaigrmaa
    pgkrlsiriedagqaslavglntqrigstrlwntrqydrprflkspdiklqanqsvalvs
    pyggllqlvysgatpgqtvtvkvtgaasqpfldiqpgedssqaiadfiqaldadkadwle
    irsgsvevhakvekvrgsidkdyggdvqrfirelnevfiddaytlagfaipnqaktpaiq
    qecaargwdcdsetlhklpgtqhinvdqyaqcgggcsgnpydqtwglnprgwgeshelgh
    nlqvnrlkvyggrsgeisnqifplhkdwrvlrefgqnlddtrvnyrnaynlivagraead
    plagvykrlwedpgtyalngermafytqwvhywadlkndplqgwdiwtllylhqrqvdks
    dwdankaalgygtyaqrpgnsgdasstdgndnlllglswltqrdqrptfalwgirtsaaa
    qaqvaaygfaeqpaffyannrtneystvklldmsqgspawpfple
    

    Sequence, based on observed residues (ATOM records):
    >5kdwA (A:)
    atqeeildaalvsgdssqltdshlvalrlqqqverirqtrtqlldglyqnlsqaydpgaa
    smwvlpanpdntlpfligdkgrvlaslsleaggrglaygtnvltqlsgtnaahapllkra
    vqwlvngdpgaatakdfkvsvvgvdktaalnglksaglqpadaacnaltdascastskll
    vlgngasaaslsatvrarlqaglpilfvhtngwnqsstgqqilaglglqegpyggnywdk
    drvpssrtrtrsvelggaygqdpalvqqivdgswrtdydwskctsyvgrttcddvpglsd
    fskrvdvlkgaldaynqkaqnlfalpgttslrlwllwadavrqnirypmdkaadtarfqe
    tfvadaivgyvreagaaqkelgsyagqrqqsmpvsgseetltltlpsaqgftaigrmaap
    gkrlsiriedagqaslavglntqrigstrlwntrqydrprflkspdiklqanqsvalvsp
    yggllqlvysgatpgqtvtvkvtgaasqpfldiqpgedssqaiadfiqaldadkadwlei
    rsgsvevhakvekvrgsidkdyggdvqrfirelnevfiddaytlagfaipnqaktpaiqq
    ecaargwdcdsetlhklpgtqhinvdqyaqcgggcsgnpydqtwglnprgwgeshelghn
    lqvnrlkvyggrsgeisnqifplhkdwrvlrefgqnlddtrvnyrnaynlivagraeadp
    lagvykrlwedpgtyalngermafytqwvhywadlkndplqgwdiwtllylhqrqvdksd
    wdankaalgygtyaqrpgnsgdasstdgndnlllglswltqrdqrptfalwgirtsaaaq
    aqvaaygfaeqpaffyannrtneystvklldmsqgspawpfpl
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5kdwB (B:)
    matqeeildaalvsgdssqltdshlvalrlqqqverirqtrtqlldglyqnlsqaydpga
    asmwvlpanpdntlpfligdkgrvlaslsleaggrglaygtnvltqlsgtnaahapllkr
    avqwlvngdpgaatakdfkvsvvgvdktaalnglksaglqpadaacnaltdascastskl
    lvlgngasaaslsatvrarlqaglpilfvhtngwnqsstgqqilaglglqegpyggnywd
    kdrvpssrtrtrsvelggaygqdpalvqqivdgswrtdydwskctsyvgrttcddvpgls
    dfskrvdvlkgaldaynqkaqnlfalpgttslrlwllwadavrqnirypmdkaadtarfq
    etfvadaivgyvreagaaqkelgsyagqrqqsmpvsgseetltltlpsaqgftaigrmaa
    pgkrlsiriedagqaslavglntqrigstrlwntrqydrprflkspdiklqanqsvalvs
    pyggllqlvysgatpgqtvtvkvtgaasqpfldiqpgedssqaiadfiqaldadkadwle
    irsgsvevhakvekvrgsidkdyggdvqrfirelnevfiddaytlagfaipnqaktpaiq
    qecaargwdcdsetlhklpgtqhinvdqyaqcgggcsgnpydqtwglnprgwgeshelgh
    nlqvnrlkvyggrsgeisnqifplhkdwrvlrefgqnlddtrvnyrnaynlivagraead
    plagvykrlwedpgtyalngermafytqwvhywadlkndplqgwdiwtllylhqrqvdks
    dwdankaalgygtyaqrpgnsgdasstdgndnlllglswltqrdqrptfalwgirtsaaa
    qaqvaaygfaeqpaffyannrtneystvklldmsqgspawpfple
    

    Sequence, based on observed residues (ATOM records):
    >5kdwB (B:)
    atqeeildaalvsgdssqltdshlvalrlqqqverirqtrtqlldglyqnlsqaydpgaa
    smwvlpanpdntlpfligdkgrvlaslsleaggrglaygtnvltqlsgtnaahapllkra
    vqwlvngdpgaatakdfkvsvvgvdktaalnglksaglqpadaacnaltdascastskll
    vlgngasaaslsatvrarlqaglpilfvhtngwnqsstgqqilaglglqegpyggnywdk
    drvpssrtrtrsvelggaygqdpalvqqivdgswrtdydwskctsyvgrttcddvpglsd
    fskrvdvlkgaldaynqkaqnlfalpgttslrlwllwadavrqnirypmdkaadtarfqe
    tfvadaivgyvreagaaqkelgsyagqrqqsmpvsgseetltltlpsaqgftaigrmaap
    gkrlsiriedagqaslavglntqrigstrlwntrqydrprflkspdiklqanqsvalvsp
    yggllqlvysgatpgqtvtvkvtgaasqpfldiqpgedssqaiadfiqaldadkadwlei
    rsgsvevhakvekvrgsidkdyggdvqrfirelnevfiddaytlagfaipnqaktpaiqq
    ecaargwdcdsetlhklpgtqhinvdqyaqcgggcsgnpydqtwglnprgwgeshelghn
    lqvnrlkvyggrsgeisnqifplhkdwrvlrefgqnlddtrvnyrnaynlivagraeadp
    lagvykrlwedpgtyalngermafytqwvhywadlkndplqgwdiwtllylhqrqvdksd
    wdankaalgygtyaqrpgnsgdasstdgndnlllglswltqrdqrptfalwgirtsaaaq
    aqvaaygfaeqpaffyannrtneystvklldmsqgspawpfpl