PDB entry 5kdg

View 5kdg on RCSB PDB site
Description: crystal structure of salmonella typhimurium effector gtge
Deposited on 2016-06-08, released 2016-11-16
The last revision was dated 2020-01-08, with a file datestamp of 2020-01-03.
Experiment type: XRAY
Resolution: 1.73 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Gifsy-2 prophage protein
    Species: Salmonella typhimurium [TaxId:90371]
    Gene: SBOV09681, DD95_21385, ERS450001_01848, SEETMRM9437_5135, TJ44_09000
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9XC73 (Start-190)
      • engineered mutation (21)
      • engineered mutation (99)
      • expression tag (191-196)
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5kdgA (A:)
    mtatpqgqiihhrnfqslynnswvcslnviksrdgnnysaleditsdnqafnnilegidi
    iecenllkemnvqkipesslftnikealqaevfnstvednfesfisyelqnhgplmlirp
    slgseclhaecivgydsevkkvliydsmntspewqsnidvydkltlafndkyknedcsic
    glyydgvyepklehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5kdgA (A:)
    qgqiihhrnfqslynnswvcslnviksrdgnnysaleqafnnilegidiiecenllkemn
    vqkipesslftnikealqaevfnstvednfesfisyelqnhgplmlirpslgseclhaec
    ivgydsevkkvliydsmntspewqsnidvydkltlafndkyknedcsicglyydgvyepk
    lehhhh