PDB entry 5kcq

View 5kcq on RCSB PDB site
Description: crystal structure of the aromatic prenyltransferase atapt from aspergillus terreus a8-4 in complex with geranyl s-thiolodiphosphate
Deposited on 2016-06-06, released 2016-12-21
The last revision was dated 2017-07-05, with a file datestamp of 2017-06-30.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aromatic prenyltransferase
    Species: Aspergillus terreus [TaxId:33178]
    Database cross-references and differences (RAF-indexed):
    • PDB 5KCQ
  • Chain 'B':
    Compound: Aromatic prenyltransferase
    Species: Aspergillus terreus [TaxId:33178]
    Database cross-references and differences (RAF-indexed):
    • PDB 5KCQ
  • Heterogens: GST, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5kcqA (A:)
    gplgsrpwqilsqalgfpnydqelwwqntaetlnrvleqcdysvhlqykylafyhkyilp
    slgpfrrpgvepeyisglshgghpleisvkidkskticrlglqaigplagtardplnsfg
    drellknlatllphvdlrlfdhfnaqvgldraqcavattklikeshnivctsldlkdgev
    ipkvyfstipkglvtetplfdltfaaieqmevyhkdaplrtalsslkdflrprvptdasi
    tppltgligvdcidpmlsrlkvylatfrmdlslirdywtlgglltdagtmkglemvetla
    ktlklgdeacetldaerlpfginyamkpgtaelappqiyfpllgindgfiadalveffqy
    mgwedqanrykdelkakfpnvdisqtknvhrwlgvaysetkgpsmniyydvvagnvarv
    

    Sequence, based on observed residues (ATOM records):
    >5kcqA (A:)
    rpwqilsqalgfpnydqelwwqntaetlnrvleqcdysvhlqykylafyhkyilpslgpf
    rrpgvepeyisglshgghpleisvkidkskticrlglqaigplagtardplnsfgdrell
    knlatllphvdlrlfdhfnaqvgldraqcavattklikeshnivctsldlkdgevipkvy
    fstipkglvtetplfdltfaaieqmevyhkdaplrtalsslkdflrprvptdasitpplt
    gligvdcidpmlsrlkvylatfrmdlslirdywtlgglltdagtmkglemvetlaktlrl
    pfginyamkpgtaelappqiyfpllgindgfiadalveffqymgwedqanrykdelkakf
    pnvdisqtknvhrwlgvaysetkgpsmniyydvvagnv
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5kcqB (B:)
    gplgsrpwqilsqalgfpnydqelwwqntaetlnrvleqcdysvhlqykylafyhkyilp
    slgpfrrpgvepeyisglshgghpleisvkidkskticrlglqaigplagtardplnsfg
    drellknlatllphvdlrlfdhfnaqvgldraqcavattklikeshnivctsldlkdgev
    ipkvyfstipkglvtetplfdltfaaieqmevyhkdaplrtalsslkdflrprvptdasi
    tppltgligvdcidpmlsrlkvylatfrmdlslirdywtlgglltdagtmkglemvetla
    ktlklgdeacetldaerlpfginyamkpgtaelappqiyfpllgindgfiadalveffqy
    mgwedqanrykdelkakfpnvdisqtknvhrwlgvaysetkgpsmniyydvvagnvarv
    

    Sequence, based on observed residues (ATOM records):
    >5kcqB (B:)
    rpwqilsqalgfpnydqelwwqntaetlnrvleqcdysvhlqykylafyhkyilpslgpf
    rrpgvepeyisglshgghpleisvkidkskticrlglqaigplagtardplnsfgdrell
    knlatllphvdlrlfdhfnaqvgldraqcavattklikeshnivctsldlkdgevipkvy
    fstipkglvtetplfdltfaaieqmevyhkdaplrtalsslkdflrprvptdasitpplt
    gligvdcidpmlsrlkvylatfrmdlslirdywtlgglltdagtmkglemvetlaktllp
    fginyamkpgtaelappqiyfpllgindgfiadalveffqymgwedqanrykdelkakfp
    nvdisqtknvhrwlgvaysetkgpsmniyydvvagnv