PDB entry 5kcn

View 5kcn on RCSB PDB site
Description: crystal structure of full-length lpoa from haemophilus influenzae at 1.97 angstrom resolution
Deposited on 2016-06-06, released 2017-09-13
The last revision was dated 2019-12-11, with a file datestamp of 2019-12-06.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Penicillin-binding protein activator LpoA
    Species: Haemophilus influenzae [TaxId:71421]
    Gene: lpoA, HI_1655
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5kcnA (A:)
    nftqtlqkdanassefyinklgqtqeledqqtykllaarvlirenkveqsaallrelgel
    ndaqkldraliearisaaknanevaqnqlraldlnklspsqksryyetlaivaenrkdmi
    eavkariemdknltdvqrhqdnidktwallrsantgvinnasdegnaalggwltlikayn
    dyirqpvqlsqalqswknaypnhaaatlfpkelltllnfqqtnvsqiglllplsgdgqil
    gttiqsgfndakgnstipvqvfdtsmnsvqdiiaqakqagiktlvgpllkqnldviladp
    aqiqgmdvlalnatpnsraipqlcyyglspedeaesaankmwndgvrnplvampqndlgq
    rvgnafnvrwqqlagtdaniryynlpadvtyfvqennsnttalyavasptelaemkgylt
    nivpnlaiyassrasasatntntdfiaqmngvqfsdipffkdtnspqyqklakstggeyq
    lmrlyamgadawllinqfnelrqvpgyrlsgltgilsadtncnverdmtwyqyqdgaivp
    van
    

    Sequence, based on observed residues (ATOM records):
    >5kcnA (A:)
    ftqtlqkdanassefyinklgqtqeledqqtykllaarvlirenkveqsaallrelgeln
    daqkldraliearisaaknanevaqnqlraldlnklspsqksryyetlaivaenrkdmie
    avkariemdknltdvqrhqdnidktwallrsantgvinnasdegnaalggwltlikaynd
    yirqpvqlsqalqswknaypnhaaatlfpkelltllnfqqtnvsqiglllplsgdgqilg
    ttiqsgfndakgnstipvqvfdtsmnsvqdiiaqakqagiktlvgpllkqnldviladpa
    qiqgmdvlalnatpnsraipqlcyyglspedeaesaankmwndgvrnplvampqndlgqr
    vgnafnvrwqqlagtdaniryynlpadvtyfvqennstalyavasptelaemkgyltniv
    pnlaiyassrasasatntntdfiaqmngvqfsdipffkdtnspqyqklakstggeyqlmr
    lyamgadawllinqfnelrqvpgyrlsgltgilsadtncnverdmtwyqyqdgaivpv