PDB entry 5kc8

View 5kc8 on RCSB PDB site
Description: Crystal structure of the amino-terminal domain (ATD) of iGluR Delta-2 (GluD2)
Class: signaling protein
Keywords: ionotropic glutamate receptor (iGluR), neurotransmission, Signaling protein
Deposited on 2016-06-05, released 2016-07-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-08-03, with a file datestamp of 2016-07-29.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamate receptor ionotropic, delta-2
    Species: Homo sapiens [TaxId:9606]
    Gene: GRID2, GLURD2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5kc8a_
  • Heterogens: CA, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5kc8A (A:)
    etgdsiihigaifdesakkddevfrtavgdlnqneeilqtekitfsvtfvdgnnpfqavq
    eacelmnqgilalvssigctsagslqsladamhiphlfiqrstagtprsgcgltrsnrnd
    dytlsvrppvylhdvilrvvteyawqkfiifydseydirgiqefldkvsqqgmdvalqkv
    enninkmittlfdtmrieelnryrdtlrrailvmnpataksfitevvetnlvafdchwii
    ineeindvdvqelvrrsigrltiirqtfpvpqnisqrcfrgnhrisstlcdpkdpfaqnm
    eisnlyiydtvlllanafhkkledrkwhsmaslscirknskpwqggrsmletikkggvsg
    ltgelefgenggnpnvhfeilgtnygeelgrgvrklgcwnpvtglngsltdkklennmrg
    gtkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kc8A (A:)
    dsiihigaifdesakkddevfrtavgdlnqneeilqtekitfsvtfvdgnnpfqavqeac
    elmnqgilalvssigctsagslqsladamhiphlfiqrstagtprsgcgltrsnrnddyt
    lsvrppvylhdvilrvvteyawqkfiifydseydirgiqefldkvsqqgmdvalqkvenn
    inkmittlfdtmrieelnryrdtlrrailvmnpataksfitevvetnlvafdchwiiine
    eindvdvqelvrrsigrltiirqtfpvpqnisqrcfrgnhrisstlcdpkdpfaqnmeis
    nlyiydtvlllanafhkkledrkwhsmaslscirknskpwqggrsmletikkggvsgltg
    elefgenggnpnvhfeilgtgvrklgcwnpvtglngsl