PDB entry 5kc2

View 5kc2 on RCSB PDB site
Description: negative stain structure of vps15/vps34 complex
Deposited on 2016-06-04, released 2016-10-05
The last revision was dated 2019-11-13, with a file datestamp of 2019-11-08.
Experiment type: EM
Resolution: 28 Å
R-factor: N/A
AEROSPACI score: -0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: Serine/threonine-protein kinase VPS15
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: VPS15, GRD8, VAC4, VPL19, YBR097W, YBR0825
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Phosphatidylinositol 3-kinase VPS34
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: VPS34, END12, PEP15, VPL7, VPT29, YLR240W, L9672.10
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5kc2B (B:)
    mgaqlslvvqaspsiaifsyidvleevhyvsqlnssrflktckaldpngeivikvfikpk
    dqyslrpflqriraqsfklgqlphvlnysklietnragymirqhlknnlydrlslrpylq
    dielkfiafqllnalkdihnlnivhgdiktenilvtswnwciltdfaafikpvylpednp
    geflfyfdtskrrtcylaperfnsklyqdgksnngrltkemdifslgcviaeifaegrpi
    fnlsqlfkyksnsydvnreflmeemnstdlrnlvldmiqldpskrlscdellnkyrgiff
    pdyfytfiydyfrnlvtmttstpisdntctnstlednvklldettekiyrdfsqichcld
    fplikdggeigsdppilesykieieisrflntnlyfpqnyhlvlqqftkvsekiksvkee
    callfisylshsirsivstatklknlellavfaqfvsdenkidrvvpyfvccfedsdqdv
    qalslltliqvltsvrklnqlnenifvdyllprlkrllisnrqntnylrivfanclsdla
    iiinrfqeftfaqhcndnsmdnnteimesstkysakliqsvedltvsfltdndtyvkmal
    lqnilplckffgrertndiilshlitylndkdpalrvsliqtisgisillgtvtleqyil
    plliqtitdseelvvisvlqslkslfktglirkkyyidiskttsplllhpnnwirqftlm
    iiieiinklskaevycilypiirpffefdvefnfksmiscckqpvsrsvynllcswsvra
    skslfwkkiitnhvdsfgnnriefitknyssknygfnkrdtksssslkgiktsstvyshd
    nkeipltaedrnwidkfhiigltekdiwkivalrgyvirtarvmaanpdfpynnsnyrpl
    vqnsppnlnltnimprniffdvefaeestsegqdsnlenqqiykydesekdsnklnings
    kqlstvmdingslifknksiatttsnlknvfvqleptsyhmhspnhglkdnanvkperkv
    vvsnsyegdvesiekflstfkilpplrdykefgpiqeivrspnmgnlrgkliatlmenep
    nsitssavspgetpylitgsdqgvikiwnlkeiivgevysssltydcsstvtqitmipnf
    dafavsskdgqiivlkvnhyqqesevkflncecirkinlknfgkneyavrmrafvneeks
    llvaltnlsrviifdirtlerlqiiensprhgavssicideeccvlilgttrgiidiwdi
    rfnvlirswsfgdhapithvevcqfygknsvivvggssktfltiwnfvkghcqyafinsd
    eqpsmehflpiekgleelnfcgirslnalstisvsndkilltdeatssivmfslnelsss
    kavispsrfsdvfiptqvtanltmllrkmkrtsthsvddslyhhdiinsistcevdetpl
    lvacdnsgligifq
    

    Sequence, based on observed residues (ATOM records):
    >5kc2B (B:)
    qaspsiaifsyidvleevhyvsqlnssrflktckaldpngeivikvfikpkdqyslrpfl
    qriraqsfklgqlphvlnysklietnragymirqhlknnlydrlslrpylqdielkfiaf
    qllnalkdihnlnivhgdiktenilvtswnwciltdfaaftcylaperfnsklyqdgksn
    ngrltkemdifslgcviaeifaegrpifnlsqlfkyksnsydvnrstdlrnlvldmiqld
    pskrlscdellnkyrgiffpdyfytfiydyfrnlvtmtntctnstlednvklldetteki
    yrdfsqichcldfplikdggeigsdppillvlqqftkvsekiksvkeecallfisylshs
    irsivstatklknlellavfaqfvsdenkidrvvpyfvccfedsdqdvqalslltliqvl
    tsvrklnqlnenifvdyllprlkrllisnrqntnylrivfanclsdlaiiinrfqeftfa
    qhcndnsstkysakliqsvedltvsfltdndtyvkmallqnrertndiilshlitylndk
    dpalrvsliqtisgisillgtvtleqyilplliqtitdseelvvisvlqslkslfktgli
    rkkyyidiskttsplllhpnnwirqftlmiiieiinklskaevycilypiivefnfksmi
    scckqpvsrsvynllcswsvraskslfwkkiitnhvdsfgnnriefitkstvyshdnkei
    pltaedrnwidkfhiigltekdiwkivalrgyvirtarvmaanpnlknvfvqleptsyhm
    hspnhglkdnanvkperkvvvsnsyegdvesiekflstfkilpplrdykefgpiqeivrs
    pnmgnlrgkliatlmenepnsitssavspgetpylitgsdqgvikiwnlkeiivgevyss
    sltydcsstvtqitmipnfdafavsskdgqiivlkvnhyqqesevkflncecirkinlkn
    fgkneyavrmrafvneeksllvaltnlsrviifdirtlerlqiiensprhgavssicide
    eccvlilgttrgiidiwdirfnvlirswsfgdhapithvevcqfygknsvivvggssktf
    ltiwnfvkghcqyafinsdeqpsmehflpiekgleelnfcgirslnalstisvsndkill
    tdeatssivmfslnelssskavispsrfsdvfiptqvtanltmllrkmkslyhhdiinsi
    stcevdetpllvacdnsgligifq
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5kc2C (C:)
    mslnnitfcvsqdldvplkvkiksleghkpllkpsqkilnpelmligsnvfpssdlivsl
    qvfdkernrnltlpiytpyipfrnsrtwdywltlpirikqltfsshlriilweyngskqi
    pffnletsifnlkdctlkrgfeslkfrydvidhcevvtdnkdqenlnkyfqgeftrlpwl
    deitisklrkqrenrtwpqgtfvlnlefpmlelpvvfiereimntqmniptlknnpglst
    dlrepnrndpqikislgdkyhstlkfydpdqpnndpieekyrrlerasknanldkqvkpd
    ikkrdylnkiinyppgtkltahekgsiwkyryylmnnkkaltkllqstnlreeservevl
    elmdswaeididdalellgstfknlsvrsyavnrlkkasdkelelyllqlveavcfenls
    tfsdksnseftivdavssqklsgdsmllstshanqkllksissesetsgteslpivispl
    aeflirralvnprlgsffywylksesedkpyldqilssfwsrldkksrnilndqvrlinv
    lreccetikrlkdttakkmellvhlletkvrplvkvrpialpldpdvlicdvcpetskvf
    ksslsplkitfkttlnqpyhlmfkvgddlrqdqlvvqiislmnellknenvdlkltpyki
    latgpqegaiefipndtlasilskyhgilgylklhypdenatlgvqgwvldnfvkscagy
    cvityilgvgdrhldnllvtpdghffhadfgyilgqdpkpfpplmklppqiieafggaes
    snydkfrsycfvaysilrrnaglilnlfelmktsnipdiridpngailrvrerfnlnmse
    edatvhfqnlindsvnallpividhlhnlaqywrt
    

    Sequence, based on observed residues (ATOM records):
    >5kc2C (C:)
    nnitfcvsqdldvplkvkiksleghkpllkpsqkilnpelmligsnvfpssdlivslqvf
    dkernrnltlpiytpyipfrnsrtwdywltlpirikqltfsshlriilweyngskqipff
    nletsifnlkdctlkrgfeslkfrydvidhcevvtdnkdqenlnkyfqgeftrlpwldei
    tisklrkqrenrtwpqgtfvlnlefpmlelpvvfiereimntndpieekyrrleraskna
    nldkqvkpdikkrdylnkiinyppgtkltahekgsiwkyryylmnnkkaltkllqstnlr
    eeservevlelmdswaeididdalellgstfknlsvrsyavnrlkkasdkelelyllqlv
    eavcfenlstfsdksnseftivdavsplaeflirralvnprlgsffywylksesedkpyl
    dqilssfwsrldkksrnilndqvrlinvlreccetikrlkdttakkmellvhlletkvrp
    lvkvrpialpldpdvlicdvcpetskvfksslsplkitfkttlnqpyhlmfkvgddlrqd
    qlvvqiislmnellknenvdlkltpykilatgpqegaiefipndtlasilskyhgilgyl
    klhypdenatlgvqgwvldnfvkscagycvityilgvgdrhldnllvtpdghffhadfgy
    ilgqdpkpfpplmklppqiieafggaessnydkfrsycfvaysilrrnaglilnlfelmk
    tsnipdiridpngailrvrerfnlnmseedatvhfqnlindsvnallpividhlhnlaqy
    wrt