PDB entry 5kbq

View 5kbq on RCSB PDB site
Description: Pak1 in complex with bis-anilino pyrimidine inhibitor
Class: transferase
Keywords: Serine/threonine-protein kinase PAK1, KINASE, TRANSFERASE
Deposited on 2016-06-03, released 2016-09-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-01-11, with a file datestamp of 2017-01-06.
Experiment type: XRAY
Resolution: 2.58 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase PAK 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PAK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13153 (0-288)
      • engineered mutation (135)
      • engineered mutation (169)
      • engineered mutation (249)
    Domains in SCOPe 2.07: d5kbqa_
  • Chain 'B':
    Compound: Serine/threonine-protein kinase PAK 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PAK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13153 (Start-288)
      • engineered mutation (135)
      • engineered mutation (169)
      • engineered mutation (249)
    Domains in SCOPe 2.07: d5kbqb_
  • Heterogens: IPV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5kbqA (A:)
    leklrsivsvgdpkkkytrfekigqgasgtvytamdvatgqevaikqmnlqqqpkkelii
    neilvmrenknpnivnyldsylvgdelwvvmeylaggsltdvvtetcmdegqiaavcrec
    lqaleflhsnqvihrniksdnillgmdgsvkltdfgfcaqitpeqskrsemvgtpywmap
    evvtrkaygpkvdiwslgimaiemiegeppylnenplralyliatngtpelqnpeklsai
    frdflnrcldmdvekrgsakellqhqflkiakplssltpliaaakeatk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5kbqB (B:)
    leklrsivsvgdpkkkytrfekigqgasgtvytamdvatgqevaikqmnlqqqpkkelii
    neilvmrenknpnivnyldsylvgdelwvvmeylaggsltdvvtetcmdegqiaavcrec
    lqaleflhsnqvihrniksdnillgmdgsvkltdfgfcaqitpeqskrsemvgtpywmap
    evvtrkaygpkvdiwslgimaiemiegeppylnenplralyliatngtpelqnpeklsai
    frdflnrcldmdvekrgsakellqhqflkiakplssltpliaaakeatk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kbqB (B:)
    eklrsivsvgdpkkkytrfekiggtvytamdvatgqevaikqmnlqqqpkkeliineilv
    mrenknpnivnyldsylvgdelwvvmeylaggsltdvvtetcmdegqiaavcreclqale
    flhsnqvihrniksdnillgmdgsvkltdskrsemvgtpywmapevvtrkaygpkvdiws
    lgimaiemiegeppylnenplralyliatngtpelqnpeklsaifrdflnrcldmdvekr
    gsakellqhqflkiakplssltpliaaakeatk