PDB entry 5kbn

View 5kbn on RCSB PDB site
Description: The crystal structure of fluoride channel Fluc Ec2 F80I Mutant
Class: transport protein
Keywords: alpha helix, ion channel, membrane protein, TRANSPORT PROTEIN
Deposited on 2016-06-03, released 2016-08-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 2.48 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative fluoride ion transporter crcb
    Species: Escherichia coli [TaxId:562]
    Gene: crcB, AC789_145pl00540, AKG99_27195, AL505_410006, AN206_26275, AUQ25_20445, ECONIH1_26550, ECS286_0026, MJ49_27125, pCTXM15_EC8_00123, pO103_22, SK78_04822
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6J5N4
      • engineered mutation (24)
      • engineered mutation (79)
  • Chain 'B':
    Compound: putative fluoride ion transporter crcb
    Species: Escherichia coli [TaxId:562]
    Gene: crcB, AC789_145pl00540, AKG99_27195, AL505_410006, AN206_26275, AUQ25_20445, ECONIH1_26550, ECS286_0026, MJ49_27125, pCTXM15_EC8_00123, pO103_22, SK78_04822
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6J5N4 (0-125)
      • engineered mutation (24)
      • engineered mutation (79)
  • Chain 'C':
    Compound: monobody
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5KBN (Start-96)
    Domains in SCOPe 2.08: d5kbnc_
  • Chain 'D':
    Compound: monobody
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5KBN (Start-96)
    Domains in SCOPe 2.08: d5kbnd_
  • Heterogens: NA, DMU, F, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5kbnC (C:)
    gsvssvptklevvaatptslliswdapavtvvhyvitygetggnspvqeftvpgskstat
    isglkpgvdytitvytmyysysdlysysspisinyrt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kbnC (C:)
    svssvptklevvaatptslliswdapavtvvhyvitygetggnspvqeftvpgskstati
    sglkpgvdytitvytmyysysdlysysspisinyrt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5kbnD (D:)
    gsvssvptklevvaatptslliswdapavtvvhyvitygetggnspvqeftvpgskstat
    isglkpgvdytitvytmyysysdlysysspisinyrt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kbnD (D:)
    svssvptklevvaatptslliswdapavtvvhyvitygetggnspvqeftvpgskstati
    sglkpgvdytitvytmyysysdlysysspisinyrt